(data stored in ACNUC1104 zone)

EMBL: CP000959.PE57

CP000959.PE57        Location/Qualifiers
FT   CDS_pept        complement(65995..66369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_3703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3242"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92398"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8Q1"
FT                   /protein_id="ACA92398.1"
FT                   /translation="MRLIPMARPAATLSLAASCLMLHGCAWFDSWLPFSYSRTPLARAA
FT                   SRHGATRADVVRAAGNPRSVWMVRNGSGVCYNYFIEHGNDHRAFFVVFDKTGVVTQHGF
FT                   DSCMDADRKGTLQQGKSASR"
     atgcgattga ttccgatggc ccgtcccgca gcgacgctgt ccctggccgc cagctgcctg        60
     atgttgcacg gctgtgcgtg gttcgactcg tggctgccgt tttcgtattc gcgcacgccg       120
     ctggcacggg ccgcgtcgcg gcacggcgcg acgcgcgccg acgtcgtccg cgccgccggc       180
     aacccgcgca gcgtctggat ggtccgcaac ggcagcggcg tctgctacaa ctacttcatc       240
     gagcacggca acgatcatcg tgctttcttc gtcgtgttcg acaagaccgg cgtcgtcaca       300
     caacacggct tcgattcgtg catggacgcc gaccgcaagg gcacgctcca gcagggcaag       360
     agcgcgtcgc gatag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page