(data stored in ACNUC1104 zone)

EMBL: CP000959.PE570

CP000959.PE570       Location/Qualifiers
FT   CDS_pept        complement(669916..671949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3759"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; HI0933 family protein; KEGG:
FT                   bur:Bcep18194_B2335 NADH/flavin oxidoreductase/NADH
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3759"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92911"
FT                   /db_xref="GOA:B1K4Y7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Y7"
FT                   /protein_id="ACA92911.1"
FT                   /translation="MTTPFPHLLAPLDLGFTTLKNRVLMGSMHTGLEDSRKTLPRLAEY
FT                   FAERARGGVGLIVTGGFAPNVAGWTKPFGGTLMTSAAARRHREITGAVHAEDGKIALQI
FT                   LHTGRYGYHPFAVAPSKIKSPISPFAPHELSARGVERQIRAFVRCATLAREAGYDGVEI
FT                   MGSEGYLINQFISMHTNKRTDQWGGSYENRIRLPIEIVERTREAVGRDFILIYRLSMLD
FT                   LIPDGSDWSETVQLAKAVERAGATIINTGIGWHEARVPTIATSVPRGAFAWVTKKMKGE
FT                   VGIPLVTTNRINRPEVAEQILADGCADMVSMARPLLADAEFVVKAAQGRADEINTCIGC
FT                   NQACLDHAFKNKIASCLLNPRACHETELKYTPAPQPKRIAVVGAGPAGLACSTVLAQRG
FT                   HQVDLFDGAAEIGGQFNMAKRIPGKEEFHEALSYFGRQVELTGVKLHLNRRVDASHLIA
FT                   GGYDEIVLATGVAPRDPKIPGQDGPNVLSYIDVLAGKQRVGRRVAVVGAGGIGFDVAEY
FT                   LVQDGESPALDLDEWKAEWGVTDPATTRGGVTRAQVSAPAREVTLLQRKAAPLGKGLGK
FT                   TTGWIHRATLKMKQVKMIGGVNYERIDAGGLHVSYGEQRTDHELIEADTIVLCTGQEPQ
FT                   RALLAPLQAAGRSVHLIGGAELAAELDAKRAIDQGARLAARL"
     atgacgacac cctttcccca cctgctcgcc ccgctcgatc tcggcttcac gacgctgaag        60
     aatcgcgtgc tgatgggctc gatgcacacc ggcctcgagg acagccgcaa gacgctgccg       120
     cgcctcgctg aatatttcgc cgagcgtgcg cgcggcgggg tcggcctgat cgtgacgggc       180
     ggcttcgcgc cgaacgtggc cggctggacc aagccgttcg gcggcacgct gatgacgtcg       240
     gccgccgcgc gccggcatcg cgagatcacc ggcgccgtgc atgcggagga cggcaagatc       300
     gcgctgcaga tcctgcatac ggggcgctac ggttatcacc cgttcgcggt cgcgccgtcg       360
     aagatcaagt cgccgatttc gccgttcgcg ccgcacgaac tgagcgcgcg cggcgtcgag       420
     cggcagatcc gcgcgttcgt gcgctgcgcg acgctcgcac gcgaggccgg ctacgacggc       480
     gtcgagatca tgggctccga gggctacctg atcaaccagt tcatctcgat gcatacgaac       540
     aagcgcaccg accagtgggg cggttcgtac gagaaccgca tccgcctgcc gatcgagatc       600
     gtcgagcgca cgcgcgaagc ggtcggccgc gacttcatcc tgatctaccg gctgtcgatg       660
     ctggacctga ttccggacgg cagcgactgg agcgaaaccg tgcagctcgc taaggcggtc       720
     gaacgggcgg gcgcgacgat catcaacacg gggatcggct ggcacgaggc gcgcgtgccg       780
     acgatcgcga cgtcggtgcc gcgcggcgcg ttcgcgtggg tgacgaagaa gatgaagggc       840
     gaggtcggca tcccgctcgt gacgaccaac cggatcaacc ggcccgaagt ggccgagcag       900
     attctcgcgg acggctgcgc ggacatggta tcgatggcgc gcccgctgct cgcggatgcc       960
     gagttcgtcg tgaaggccgc gcagggccgc gccgatgaga tcaacacctg catcggctgt      1020
     aaccaggcgt gcctcgatca cgcgttcaag aacaagattg cgtcgtgcct gctgaatccg      1080
     cgcgcgtgcc acgagacgga gctgaaatac acgcccgcgc cgcagccgaa gcgcatcgcg      1140
     gtggtcggcg cggggccggc cgggctcgcg tgctcgaccg tgctcgcgca gcgcggccat      1200
     caggtcgacc tgttcgatgg cgcggccgag atcggcggcc agttcaacat ggcgaagcgg      1260
     attccgggca aggaggagtt tcacgaagcg ctgagctact tcggtcggca ggtcgagttg      1320
     accggcgtga agctgcacct gaaccgccgc gtcgatgcga gccacctgat cgcgggcggc      1380
     tacgacgaga tcgtgctggc gaccggcgtc gcgccgcgcg acccgaagat tccgggacag      1440
     gacgggccga acgtgctcag ctatatcgac gtgctcgcgg gcaaacagcg ggtgggccga      1500
     cgggtcgcgg tggtcggcgc gggcgggatc ggcttcgatg tcgccgagta tctggtgcag      1560
     gacggcgagt cgccggcact cgatctggat gaatggaaag ccgagtgggg cgtgaccgac      1620
     ccggccacga cgcgcggcgg cgtgacgcgt gcgcaggtgt cggcgccggc ccgggaagtg      1680
     acgctgttgc agcgcaaggc cgcgccgctc ggcaaggggc tcggcaagac gaccggctgg      1740
     attcaccgtg cgacgctgaa gatgaagcag gtgaagatga tcggcggcgt gaactacgag      1800
     cggatcgatg cgggcgggct gcatgtgtcg tacggcgagc agcgcaccga ccacgaactg      1860
     atcgaagccg atacgatcgt gctctgcacg gggcaggagc cgcagcgcgc attgctcgcg      1920
     ccgttgcagg cggccgggcg ctcggtgcac ctgatcggcg gcgccgaact ggccgccgaa      1980
     ctcgatgcga agcgcgcgat cgatcagggt gcgcggctgg cggcgcggct gtaa            2034
//

If you have problems or comments...

PBIL Back to PBIL home page