(data stored in ACNUC1104 zone)

EMBL: CP000959.PE572

CP000959.PE572       Location/Qualifiers
FT   CDS_pept        673300..673845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3761"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3761"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92913"
FT                   /db_xref="GOA:B1K4Y9"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Y9"
FT                   /protein_id="ACA92913.1"
FT                   /translation="MPNRTTLIEATIDRVDTNLIRVKADVRKHPPYRLTMQNVCYFVTA
FT                   NDIDEEAFKQIQKLRPGMSVRACTFEHRGRRRIAWIRSGSLAIAPYDVRAQKRRNLSLL
FT                   AWASCLVVLSLGTAAAALHSGWAFTSALATVVSIVGLVGDLVAIGGLSDLIFQPQRREA
FT                   QDCWLGEPSGFSAERSSP"
     atgcccaatc gcaccaccct gatcgaggcc acgatcgacc gtgtcgatac caacctcatc        60
     cgagtcaagg ccgatgtcag gaagcacccg ccataccgtc tgacgatgca gaacgtctgc       120
     tacttcgtca cggccaacga catcgacgaa gaagcattca agcagatcca gaaactgagg       180
     cccggcatgt cggtgcgcgc ctgcacattc gagcatcgcg gccgtcgccg gatcgcgtgg       240
     atcaggagcg gcagccttgc catcgcgccg tacgacgtgc gcgcgcaaaa gcgacggaac       300
     ctgtcgctgc tcgcctgggc gtcgtgcctg gtcgtgctga gcctgggtac cgctgccgcg       360
     gcactccatt cgggttgggc gttcacctcg gcactggcca ccgtcgtgtc catcgtcggt       420
     ctggtgggcg acctggtcgc catcggcggc ttgtccgacc tgatcttcca gccgcagcga       480
     cgcgaagccc aggattgctg gctaggcgaa ccgtccggtt tcagcgcgga gcggagcagc       540
     ccatga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page