(data stored in ACNUC1104 zone)

EMBL: CP000959.PE574

CP000959.PE574       Location/Qualifiers
FT   CDS_pept        complement(674544..675023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3763"
FT                   /product="protein of unknown function DUF126"
FT                   /note="PFAM: protein of unknown function DUF126; KEGG:
FT                   bur:Bcep18194_B2339 protein of unknown function DUF126"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3763"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92915"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Z1"
FT                   /protein_id="ACA92915.1"
FT                   /translation="MTETTGTFLTGDTLVPGSACARPFVLDKPLSFWGGYDSGAGRIVD
FT                   RGHPQAGASLAGKVMVMPHAKGSSSSSSVLAEAVRNGTGPVGIVLKERDLIISIGAIVA
FT                   AELYAIAVPVVCVSDDVYDAIVAATGDVRIEAGEGDGGARIYLGADARSGGSGLT"
     atgactgaaa cgacgggcac attcttgacg ggcgacacgc tcgtgccggg cagcgcgtgc        60
     gcgcggcctt tcgtgctcga caagccgctc agcttctggg gcggctacga ctcgggcgcg       120
     ggcaggatcg tcgatcgcgg gcatccgcag gccggcgcga gcctcgccgg caaggtgatg       180
     gtgatgccgc acgcgaaggg atcgagttcg agcagcagcg tgctcgcgga agctgtgcgc       240
     aacggcacgg ggccggtcgg gatcgtgctg aaggaacgcg acctgatcat ctcgatcggc       300
     gcgatcgtgg ccgccgagct gtatgcgatc gcggtgccgg tggtgtgcgt gagcgacgat       360
     gtgtatgacg cgatcgtcgc cgcaacgggc gacgtgcgga tcgaagcggg cgagggggac       420
     ggcggcgcgc ggatttatct gggcgctgat gctcgttcgg gcggatccgg tttgacctga       480
//

If you have problems or comments...

PBIL Back to PBIL home page