(data stored in ACNUC1104 zone)

EMBL: CP000959.PE581

CP000959.PE581       Location/Qualifiers
FT   CDS_pept        681216..682658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3770"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bur:Bcep18194_B2346 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3770"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92922"
FT                   /db_xref="GOA:B1K4Z8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Z8"
FT                   /protein_id="ACA92922.1"
FT                   /translation="MKKLLVALAVSAFAAGCAVQPAQHPALNDSVQTLAPTAWDTDVPR
FT                   ADIDAAAWWAQFHDPVLDRLIATVLDSNLDLQAAAERVKQAQALTVQKRAVLLPELDAT
FT                   AHAADARQNTPPPLGYVRQAGAGLALSWSPDVFGGERLDLLAAQAELVGQKHAEDAMRL
FT                   ALAADAASAYVDLRWAQQELKILQDNAKIRQHALELTRKRQAFGLSTELDVTRAQNQLD
FT                   ALEARIPPTQAQISHQLNLIAVYSGRTPESVDRLLLAQAGEIPAPPVGAPGTLPSQALL
FT                   RRPDVLTAYAQVERRAAQVGVAKAERYPKFSLNLTDGILAASYLGLPTLTDNLFSAALS
FT                   ATSPIFNAGRITADISQSESRMRESELGLRQTMLQALREVEDARANLVSSDEATRRLGS
FT                   ALAASDKALGLANQLYKGGATDFLDVLSAQEVYLRDSDSLNQVKREHALAAVALYRSLG
FT                   GGWSRNDAAGGTQTETDAVAKN"
     atgaagaagc tactcgtcgc gctggccgtc agcgcattcg ccgccgggtg tgcagtgcag        60
     cccgcgcagc atccggcgct gaacgactcc gtccagacgc tcgcgcccac cgcgtgggat       120
     accgacgtgc cgcgcgcgga catcgacgcc gccgcctggt gggcgcagtt ccacgacccc       180
     gtgctcgacc ggctgatcgc gaccgtgctc gacagcaacc tcgatctgca agccgccgcc       240
     gaacgcgtga agcaggcgca ggcgctgacc gtgcagaaac gcgcggtgct gctgcccgaa       300
     ctcgacgcga ccgcgcatgc ggccgacgcg cggcagaaca cgccgccgcc gctcggttat       360
     gtgcggcagg ctggtgcggg tcttgcgctg agctggtcgc ccgacgtgtt cggcggtgaa       420
     cggctcgatc tgctggccgc tcaagcggag ctggtcgggc aaaagcatgc ggaagatgcg       480
     atgcgcctcg cgcttgcagc ggacgcggca tccgcgtatg tcgatctgcg ctgggcgcag       540
     caggaactga agatcctgca ggacaacgcg aagatccggc agcatgcgct cgaactcacg       600
     cgcaagcggc aggcgttcgg gctgtcgacg gaactcgacg tgacgcgtgc gcagaaccag       660
     ctcgatgcgc tcgaagcgag gattccgccg acgcaggcgc agatttcgca tcagctcaat       720
     ctgatcgccg tgtattcggg gcggacgccg gaatcggtcg atcggctttt gctggcgcag       780
     gcgggggaga ttcccgcgcc gccagttggc gcgccgggga cgctgccttc gcaggcgttg       840
     ttgcggcggc cggatgtgct gactgcctat gcgcaggttg agcggcgtgc cgcgcaggtc       900
     ggcgtggcga aggccgagcg gtatccgaag ttctcgttga acctgacgga cgggattctg       960
     gcagcttcgt atctcgggtt gccgacgttg accgataacc tgttcagtgc tgcgctgagt      1020
     gcgacgagcc cgatcttcaa cgcgggacgc attaccgccg atatctcgca gagcgaaagc      1080
     cggatgcgcg agtcggaact cgggttacgg cagacgatgc tgcaagcgct gcgggaagtc      1140
     gaagatgcgc gcgcgaatct cgtcagttcc gatgaggcaa cgcggcgact gggtagcgca      1200
     ttggcggctt ccgataaagc gcttgggctg gcgaatcagc tttataaggg cggcgcgacg      1260
     gattttctgg atgtgctgtc ggcgcaggag gtctatctgc gggattcgga ttcgctcaat      1320
     caggtcaagc gcgagcatgc gctggcggcg gtggcgttgt atcggtcgct tgggggtggg      1380
     tggagccgga atgacgcggc ggggggaaca cagacggaaa ctgacgctgt ggcgaaaaac      1440
     tag                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page