(data stored in ACNUC1104 zone)

EMBL: CP000959.PE583

CP000959.PE583       Location/Qualifiers
FT   CDS_pept        complement(684896..685180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3773"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_3620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3773"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92924"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:B1K500"
FT                   /protein_id="ACA92924.1"
FT                   /translation="MSRRFIRQGDKTDRNGVVVDGIAGTSLQGQPFAYLGAPVQCPACG
FT                   TTGVIISDGSPRAMTMMGKQVALENDLCQCKCEPLPKLMSSQTLGSIKT"
     atgagccgac ggttcattcg tcagggcgat aagaccgatc gcaacggtgt tgtggtcgac        60
     ggtatcgcag gcacctcgtt gcaaggccaa cctttcgctt atctgggcgc cccggttcaa       120
     tgtcccgcct gtggcacgac gggcgtcatc ataagcgacg gctcgccacg cgcgatgacg       180
     atgatgggta agcaggtcgc attagagaac gatttgtgcc aatgtaaatg tgagccactg       240
     ccgaagctga tgtcgtccca gactctcggt tcaataaaga catga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page