(data stored in ACNUC1104 zone)

EMBL: CP000959.PE586

CP000959.PE586       Location/Qualifiers
FT   CDS_pept        complement(688749..689552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3776"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C7608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3776"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92927"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:B1K503"
FT                   /protein_id="ACA92927.1"
FT                   /translation="MVHYVIVEVVNGKPELPGVPPVYEVGELVPAARPELEGVAPVLYC
FT                   AEHPELQLPALRERAESDLENGLPPVVCAILECGKATGRLQQHLSNRLILQAPISGDAV
FT                   FRYYDPRVFPHLGRILKAEQMDALLGPVATWTYLDPVSGWTVVNGAAEPEAAFAVTADQ
FT                   HARIARIELVQRGLDLLRCNGTAPRPDMSALLDAQLAKGEAHGLAGGDLLAFALHGTLV
FT                   SPCFDRHPRVRAILQAPRKGPYAEAVANWSAADWEAIARESIQYQ"
     atggttcact acgttatcgt cgaagtcgtg aacgggaagc ccgagttgcc tggtgtgccg        60
     ccggtctatg aagtcggtga gttggttccc gctgcgcgtc ccgaactcga gggcgtggcg       120
     cccgtgctgt attgtgcgga gcatcccgaa ctgcaattgc cagcgttgag agaacgtgcc       180
     gaatcggacc ttgagaatgg cttgccgcca gtcgtttgcg ccattctcga atgcggaaag       240
     gcgacgggcc ggcttcagca acatctgtcg aaccggttga tactgcaggc gccgatttcg       300
     ggcgatgcgg tcttccgcta ctacgacccg cgcgtgtttc cgcacttggg tcgcatcttg       360
     aaggccgagc agatggatgc gcttctgggg ccggttgcaa cgtggacgta cctcgacccc       420
     gtgagcggct ggacggtggt caacggcgcg gccgaaccgg aagccgcctt cgcggttact       480
     gcggaccagc acgcacgaat tgcgcgcatc gagttggttc agcgcgggct tgacctactc       540
     cgttgcaatg gtacggcgcc tcgtcccgat atgtcggcgc tgctcgacgc gcaacttgca       600
     aaaggagagg ctcatgggct cgccggtggg gacctgcttg cttttgcact tcacggcaca       660
     ctcgtttccc cctgctttga ccgtcacccg cgtgttcggg ccattctgca ggcgccgcgg       720
     aaaggcccgt atgctgaagc ggtagcgaac tggagcgcgg cagactggga agcgattgct       780
     cgcgagagca tccaatatca atga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page