(data stored in ACNUC1104 zone)

EMBL: CP000959.PE588

CP000959.PE588       Location/Qualifiers
FT   CDS_pept        complement(692488..692610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3778"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2348 glutathione
FT                   S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3778"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92929"
FT                   /db_xref="GOA:B1K505"
FT                   /db_xref="UniProtKB/TrEMBL:B1K505"
FT                   /protein_id="ACA92929.1"
FT                   /translation="MQTGNLRLYADAQYSSPYAMSVFVALEVAMLHKIWLACYF"
     gtgcaaaccg gcaatctccg cctctacgcg gatgcgcaat actcgagccc ttatgcgatg        60
     tcggtattcg tcgcgctcga ggttgcaatg ctccataaaa tttggctggc ctgttatttc       120
     taa                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page