(data stored in ACNUC1104 zone)

EMBL: CP000959.PE590

CP000959.PE590       Location/Qualifiers
FT   CDS_pept        693259..694170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3780"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bmu:Bmul_4992 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3780"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92931"
FT                   /db_xref="GOA:B1K507"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K507"
FT                   /protein_id="ACA92931.1"
FT                   /translation="MRITPLPPLQCLVAFEAAVRHASFTKAAAELHLTQSAISRQIQQL
FT                   EEFLGRSLFVREHRSLRLTIAGEQYAAQVHHLLTQCAEATHDVMKPYGDLELTIACSSG
FT                   VAVLWLTPRLPDFRATYPNIKLRLIVRDGLASMSPAEFDVGVYYVRQQAPAEYTARRLF
FT                   DEEVFPVCAPGYLAGRTLDAADLANETLLRLEDGQRQWMSWSEWFDLNDVDRQKAQPQD
FT                   ITINSYPQIVQMTILGQGVSLGWRYMIDACIDAGLLVRVTEASASHGGGYYVISPNDRA
FT                   QNQAARLFTRWLFEQAEQQTGA"
     atgcgcatca cgcctctccc gcccctgcag tgcctcgtcg cgttcgaagc cgccgtgcgg        60
     cacgcgagtt tcacgaaagc cgccgccgaa ctgcacctga cccaaagcgc gatcagccgc       120
     cagatccagc aactcgagga attcctcggc cgctcgctgt tcgtgcgcga gcaccgttcg       180
     ctgcggctga cgatcgccgg cgagcaatac gcggcgcagg tccaccatct gctcacgcaa       240
     tgcgcggaag ccacccacga cgtgatgaaa ccgtacggcg atctcgaact gacgatcgcg       300
     tgctcgtccg gcgtcgcggt gctgtggctc acaccgcggc taccggactt tcgcgccacg       360
     tatcccaaca tcaagctgcg cctgatcgtg cgcgacggcc tggcatcgat gtcgcccgcg       420
     gaattcgacg tcggcgtcta ctacgtgcgc cagcaggcgc cggccgaata caccgcacgc       480
     cggctgttcg acgaggaagt gttccccgtc tgcgcgcccg gctatctcgc cggccgcacg       540
     ctcgacgcgg ccgatctcgc gaacgaaacg ctgctgcgcc tcgaagacgg ccagcgtcaa       600
     tggatgtcgt ggtccgaatg gttcgacctg aacgacgtcg accggcagaa ggcgcagccg       660
     caggacatca cgatcaactc ctatccgcag atcgtgcaga tgacgattct cggtcagggc       720
     gtgtcgctcg gctggcgcta catgatcgac gcctgcatcg acgccggcct gctcgtgcgc       780
     gtgacggaag cgtccgcgag ccacggcggc ggctattacg tgatctcgcc gaacgaccgc       840
     gcgcagaacc aggccgcccg cctgttcacc cgctggctgt tcgaacaggc agagcagcaa       900
     accggggcct ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page