(data stored in ACNUC1104 zone)

EMBL: CP000959.PE594

CP000959.PE594       Location/Qualifiers
FT   CDS_pept        complement(697744..699540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3784"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csa:Csal_2378 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3784"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92935"
FT                   /db_xref="InterPro:IPR026487"
FT                   /db_xref="UniProtKB/TrEMBL:B1K511"
FT                   /protein_id="ACA92935.1"
FT                   /translation="MAERTAEKRHKKVSLNTFLLKKPAGSASGKFWSEREFLAKPLDQD
FT                   GRPRKIDVDEYSLGDKGKFGTLYVRKPLSESTPEWVGFIAPQISRSGGLEGLKNKSVSA
FT                   LLVTTVKGRQFAVAFGHGRYMLDAECIETRFGIRVALNSISPDKIASIDRQTFEATPRI
FT                   SRTQALRATSVAEYEINEQQDLLRGLVGFTLNEYKDDLGEVLAGMDSLKASVGIDLPKL
FT                   GKFLEVALKRSLAGDYRKTDNGQAGAFAWVDNLESVDRPDILDELDKMLWKLFESDDFS
FT                   TMWLAIPEIVNWEDVTGFCYTRGELESSIHAALDIKDLKKSLRSNATLDTLRHRAIHMV
FT                   LASGVPPRVYSAYKCLYAEVRYNKALYILNAGNWYCVDSSFKNLVDKYFDNTLRRNFDK
FT                   PFVEYEHDGEGKYNEAVAANLPRKYAMLDRKLISFGGKSSKIEVCDLYAASSSRTERSQ
FT                   LIHVKRGRSSATLSHLFAQGLVSSTLLVSEPGFVVEVNKQLVKQNFAKFPAKPIGSRYE
FT                   VVFAIIDGPSGAKLDLPFFSKVNLRVCGRRLQNFGFTVSLMHIPESAKFLAEARKRKAK
FT                   KQAVAKVAAKAAVRRVTRARKS"
     ttggcggaga gaacagcaga aaagaggcat aaaaaggtat cgttaaatac atttttgctc        60
     aagaagcctg ccgggagtgc gtccgggaag ttttggtcgg agcgtgaatt tcttgcgaag       120
     ccactagatc aagacggaag gccaaggaaa atcgatgtgg atgagtactc gctcggggat       180
     aagggcaagt tcgggacatt gtacgtaaga aagccattga gtgaatcaac tccggagtgg       240
     gtaggattta ttgctcctca aataagtcga tcgggtgggc ttgaagggct aaaaaataaa       300
     agtgtgtcgg cactgcttgt cactactgtc aaagggaggc agtttgcagt cgcatttggg       360
     catggtcgat atatgttgga cgcggagtgc attgaaactc gatttggaat tcgagtggcg       420
     cttaatagta tatcgccaga taaaatcgca tcaatcgacc gtcagacatt cgaggcaacg       480
     ccaagaatca gtagaacgca agcgttgcgt gcgacttccg ttgcggagta tgaaattaat       540
     gagcaacaag atttgctgcg cgggttggtt ggttttactc tgaatgagta taaagacgat       600
     ctcggggaag ttttggctgg gatggattct cttaaggcaa gtgtcggtat tgatcttccg       660
     aagttgggga aatttctcga ggttgcactt aaaagatctt tggcaggaga ctatcgaaag       720
     actgataatg ggcaggcggg cgcatttgcg tgggtggata atttggagtc ggttgatcga       780
     ccggatattt tagatgaact ggataaaatg ctatggaagt tatttgaaag tgatgatttt       840
     tcgactatgt ggttggctat tccggaaatt gtcaattggg aggatgttac gggattttgc       900
     tacactcgcg gagagttgga gtcgtcgatc catgccgctc tcgatattaa ggatctaaag       960
     aaatcattgc ggtcgaacgc cactttggat acgttgcgac atcgggcaat tcatatggtg      1020
     ttggcatcgg gggttccccc aagagtctat tctgcttaca agtgcttgta tgctgaggta      1080
     agatataata aagcgctgta tattttaaat gcaggaaatt ggtattgtgt agattcttca      1140
     tttaaaaatt tggtggataa atattttgat aatactttga ggcgtaattt cgataagccg      1200
     tttgtggagt atgagcatga tggtgagggg aaatacaatg aggcggttgc ggcaaatctt      1260
     cctcgtaagt atgcaatgct tgatcgtaaa ttgatttcct ttggtggaaa atctagcaag      1320
     attgaagttt gcgatctgta tgcggccagt tcgtctcgca ctgagagaag tcaacttatt      1380
     catgttaagc gggggcgaag ctccgccacg ttgagtcatc ttttcgcaca aggacttgtg      1440
     tcgtcaaccc tgttggtaag tgagcctggt tttgttgttg aggttaataa gcaactcgtc      1500
     aagcagaatt tcgcaaaatt ccctgcaaaa ccgatcggta gtcgttatga ggtggttttt      1560
     gcgattattg atggtccatc cggagcgaag cttgatcttc cattttttag taaggtcaat      1620
     cttagggtgt gtggacgaag gctccaaaat tttgggttta ctgtgagcct catgcatata      1680
     ccagaatccg cgaaatttct tgcagaggcc agaaaacgaa aggcaaaaaa acaagcagtt      1740
     gcaaaagttg ccgcgaaggc agcagttcgc cgggtcaccc gtgcaaggaa atcctga         1797
//

If you have problems or comments...

PBIL Back to PBIL home page