(data stored in ACNUC1104 zone)

EMBL: CP000959.PE595

CP000959.PE595       Location/Qualifiers
FT   CDS_pept        complement(700238..702100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3785"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bur:Bcep18194_B2357
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3785"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92936"
FT                   /db_xref="GOA:B1K512"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B1K512"
FT                   /protein_id="ACA92936.1"
FT                   /translation="MHFWRKLSIQNKLILSMTSCLLVFVAISSGLSVRLIGSAVRERVV
FT                   REELPTAVNGIRADVQRQMAGPIAASRILARDAFLLQWEADGEPDAGTRNWIQLAKNVK
FT                   DEQKAASVQWVSVKSGNYYNEAGLQRKVTDKDQWLTSFLSSGKAYDVNMDREVTVGGYM
FT                   MFINSRVELDGVPIGAACMSLSVDALAKGISAYRIGETGFAYLVRPDGAIMMHRDMSLI
FT                   DGKHFLKDERGLPGDASATLLAGKSYAYLSYEGDGGARFIATSFIPELNAYVVVQVPQA
FT                   ELLGPVTRAIRSAALVAAVVGFGVALLVIWLVGRAIAAPIRRAATLLSEIASGQGDLTR
FT                   RMTVESEDEIGQLSDAFNRFVSSLSTLVHRIRAASASIATGSAQIASGNADLSERTEGQ
FT                   SSNLERTASSMEEITAVVRNNTETATTAAKMINGAADTAARGGQVVGEVVTTMEQISDA
FT                   SQRISEIIVMIDSISFQTNILALNAAVEAARAGEQGRGFAVVASEVRNLAQRSAQAAKE
FT                   IKSLIEHSAGTVGAGSRLVSEAGKVMSDVVSQVQGVSAMMSEIAEASLEQSAGIDQIGD
FT                   AVQSLDQMTQQNAALVEESAAAAESLKQQAAELTKLVSAFKVAE"
     atgcatttct ggcgcaagct ttccattcag aacaagctga ttctcagcat gacgagttgc        60
     ctgctcgtgt tcgtcgcgat ttcgagcggg ctcagcgttc gtttgatcgg cagcgcggtg       120
     cgggagcgtg tcgtccgcga agaactgccg accgccgtca acggcattcg cgccgacgtg       180
     cagcgccaga tggccggccc gatcgccgcg tcgcgcattc tcgcgcgcga cgcgttcctg       240
     ctgcaatggg aagccgacgg cgaacccgat gccggcacgc gcaactggat ccagcttgcc       300
     aagaacgtga aggacgagca gaaggccgcg tccgtgcagt gggtgtcggt gaagagcggc       360
     aactactaca acgaagccgg cctgcagcgg aaggtgaccg acaaggatca gtggctgacc       420
     agtttcctgt cgtccggcaa ggcgtacgac gtgaacatgg atcgcgaggt gaccgtcggc       480
     ggctacatga tgttcatcaa cagccgcgtg gaactcgacg gcgtgccgat cggcgcggcg       540
     tgcatgagcc tgtccgtcga tgcgctcgcg aagggtattt cggcttatcg gatcggcgag       600
     accgggtttg cttacctcgt gcgacccgac ggcgcgatca tgatgcatcg cgatatgtcg       660
     ctgatcgacg gcaagcattt tctgaaggat gagcgggggc tgccggggga tgcgtcggcg       720
     acgctgcttg cgggcaagtc gtatgcgtac ctgagctacg agggtgatgg cggcgcgcgg       780
     tttatcgcga cgtcgttcat tccggaactg aatgcgtatg tggtcgttca ggtgccgcag       840
     gccgaactgc tcgggccggt aacgcgcgcg atccgcagcg cggcgctggt ggcggcggtg       900
     gtggggtttg gagttgcgtt gctcgtgatc tggctggtgg ggcgcgcgat tgccgcgccg       960
     attcgtcggg cggctacgtt gttgtcggag attgccagcg ggcaggggga tttgacgcgc      1020
     cgcatgacgg tggagagcga ggacgagatc gggcagttgt cggatgcgtt caatcggttc      1080
     gtgtcgtcgt tgtcgacgct cgttcatcgg attcgtgcgg cttcagcgtc gattgcgacc      1140
     gggtcggcgc agattgcttc ggggaatgcg gatctcagcg aacgcaccga agggcagtcg      1200
     agcaacctgg agcgcacggc ttcgtcaatg gaagagatca cggccgtggt gcgtaacaac      1260
     accgagacgg cgacgacggc tgcgaagatg atcaatggcg cggcggatac ggcggcgcgg      1320
     ggtggtcagg tggtcggcga agtcgtgacg acgatggagc agatcagcga cgcttcgcag      1380
     cgcatctccg agatcatcgt gatgatcgac agtatctcgt ttcagacgaa tattctggcg      1440
     ctgaatgctg cggtggaagc ggcgcgggcg ggggagcagg ggcgtgggtt tgctgttgtc      1500
     gcttcggagg tgcggaatct ggcgcagcgc agtgcgcagg cggcgaagga gattaagtcg      1560
     ctgatcgagc atagcgcggg gacggtgggt gccgggtcgc ggcttgttag tgaggcgggg      1620
     aaggtgatga gtgatgtggt gtcgcaggtt cagggcgtta gcgcgatgat gagcgagatc      1680
     gcggaggcta gcctggagca gagtgctggc attgatcaga tcggggatgc ggtgcagtcg      1740
     cttgatcaga tgacgcagca gaatgcggct ttggtcgagg aaagcgcggc ggcagcggag      1800
     agcttgaagc agcaggcggc ggaattgacc aagctggttt cggcttttaa ggtggctgag      1860
     taa                                                                    1863
//

If you have problems or comments...

PBIL Back to PBIL home page