(data stored in ACNUC1104 zone)

EMBL: CP000959.PE596

CP000959.PE596       Location/Qualifiers
FT   CDS_pept        complement(702272..702943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3786"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   bur:Bcep18194_B2358 outer membrane protein, OmpA/MotB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3786"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92937"
FT                   /db_xref="GOA:B1K513"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B1K513"
FT                   /protein_id="ACA92937.1"
FT                   /translation="MTARTDGASAADRDDDELEGAQSGRWLISYADLITTLMVLFLALY
FT                   VLQLAKYNALDARYQTLARQAGGAATAAVDTAKADPAPPWLALLDSLKSNGRISLVKAP
FT                   HGVEIGIDAKILFNVGDARLLPDSSPVLNQIAQALSAHTTGDILVEGHTDSVPIANAKY
FT                   ESNWELSSARAGSVVRYLSERGVAPHRLAAIGRADTQPLVAGGDAGSRARNRRVTIFVA
FT                   Y"
     atgactgctc gaactgacgg cgcatcggct gccgatcgcg acgatgacga actcgaaggc        60
     gcgcagtccg gacgctggct gatttcgtac gcggatctca tcacgacgct gatggtgctg       120
     tttctcgcac tgtatgtgct tcagctcgcg aaatacaacg cgctcgatgc gcggtatcag       180
     acgcttgcgc ggcaggctgg gggtgctgcg actgccgcgg tcgataccgc caaggccgat       240
     cctgcgccgc cgtggctcgc gttgctcgat tcgttgaaat cgaatggacg catttcgctg       300
     gtgaaggcgc cgcatggcgt cgagatcggt atcgacgcga agatactgtt caacgtcggc       360
     gatgcacgtt tgctgcccga ttcgtcgccg gtgctgaacc agatcgcgca agcattgagc       420
     gcgcatacaa ccggcgacat cctcgtcgaa gggcacaccg acagcgtgcc gatcgcgaac       480
     gcgaaatacg aatcgaactg ggagctttcg tcggcgcgcg cggggagtgt ggtgcgctac       540
     ctgagcgagc gcggtgtcgc gccgcatcga ctggcggcga tcgggcgggc cgatacgcag       600
     ccgcttgttg cggggggcga tgctggttcg agggcaagaa accggcgggt aacgattttc       660
     gttgcgtatt ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page