(data stored in ACNUC1104 zone)

EMBL: CP000959.PE599

CP000959.PE599       Location/Qualifiers
FT   CDS_pept        complement(705285..705947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3789"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bur:Bcep18194_B2364 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3789"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92940"
FT                   /db_xref="GOA:B1K516"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B1K516"
FT                   /protein_id="ACA92940.1"
FT                   /translation="MESNARTTLTISSRNYSSWSMRGWLLAKLSGLTFETISVPIDATS
FT                   RAELLLLSPSILVPCLTHDGNAVWDTLAIAEYLNEIRPQARLLPDDRHARAHCRSICGE
FT                   MHSGFSALRSALPMNLRGHFPGFRIWSRAQHDIERIVTIWRECLAEYGGPWLFGAEIGI
FT                   ADAMYAPVVTRFLTYDVKLEPDVAEYCMRVLAHPFVAEWIEEAKAEHEDIDELDMEF"
     atggaatcca acgcacggac gacgctgacc atcagcagcc gcaattattc gtcgtggtcg        60
     atgcgcggct ggttgctcgc gaagctgagc gggctcacgt tcgagacgat cagcgtgccg       120
     atcgatgcga cgtcgcgcgc ggagctgctg ctgctgtcgc catcgattct cgtgccgtgc       180
     ctgacgcatg acggcaacgc ggtgtgggac acgctcgcga tcgccgaata tctgaacgag       240
     atccgcccgc aggcgcggct gctgcccgac gaccggcatg cacgcgcgca ttgccggtcg       300
     atctgcggcg agatgcattc cggtttcagc gcgttgcgat ccgcgctgcc gatgaacctg       360
     cgcgggcatt tccccggctt ccggatctgg tcgcgcgcgc agcacgacat cgagcggatc       420
     gtgacgatct ggcgcgagtg cctggccgag tacggcggcc cctggctgtt cggtgcggag       480
     atcggcatcg ccgacgcgat gtatgcgccg gtcgtcacgc gcttcctgac ctatgacgtg       540
     aagctcgaac cggacgtcgc cgagtactgc atgcgcgtcc tcgcgcatcc gttcgtcgcc       600
     gagtggatcg aggaggcgaa ggccgagcac gaagacatcg acgagctcga catggagttc       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page