(data stored in ACNUC1104 zone)

EMBL: CP000959.PE61

CP000959.PE61        Location/Qualifiers
FT   CDS_pept        complement(70094..71122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3246"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: bam:Bamb_3699 transcriptional regulator, LacI
FT                   family; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3246"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92402"
FT                   /db_xref="GOA:B1K8Q5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8Q5"
FT                   /protein_id="ACA92402.1"
FT                   /translation="MRGVTVKVNLKALSDALGLSRTTVSRALNGYDDVSEATRERVAKA
FT                   AREMGYVADPTARRLATGRADMIGIVYPFGAGDLGDPRFAEVVAGITERLAERNLDFII
FT                   ASARPNAELDTYRRIVDGKLVDGLIVARTRVDDPRIAYLQASAFPYVAYGRTQAAGPYA
FT                   WFDFDNEAGARDAVRRLIGFGHRRIAMISAPLVLNFAAQRRAGYLSALREAGIDADPAL
FT                   LVECPFTPDGGRQAARALLALAEPPTALLVDNNIAGSGAFRVLVDSGLRLGADLSLIVY
FT                   DGVPADIAHPYRVTAVVQPTGHASGRALAELMLRLLDDGVCDQRLEAPAIEAGDTDGPL
FT                   RG"
     atgcgaggag tgacggtgaa ggtgaatctg aaggcgctgt cggacgcgct cggcctgtcg        60
     cggacgacgg tcagccgcgc gttgaacggt tacgacgacg tgagcgaggc gacgcgcgaa       120
     cgcgtggcga aggccgcgcg ggaaatgggg tacgtggccg atccgactgc gcgccggctc       180
     gcgaccggac gggccgacat gatcgggatc gtgtatccgt tcggcgccgg cgatctcggc       240
     gatccgcggt tcgccgaggt cgtcgcgggt atcaccgagc ggctcgccga gcgcaatctc       300
     gatttcatca tcgcgtccgc gcgaccgaac gcggaactgg acacctatcg gcggatcgtc       360
     gacggcaagc tcgtcgacgg gctgatcgtc gcgcgcacgc gggtcgacga tccgcggatc       420
     gcgtacctgc aagcgagcgc gttcccgtat gtcgcgtacg gtcgcacgca ggccgccggc       480
     ccgtacgcat ggttcgactt cgacaacgag gcgggcgcgc gcgacgcggt gcgccggctg       540
     atcggcttcg ggcatcggcg tatcgcgatg atcagcgcgc cgctggtgct gaatttcgcc       600
     gcgcagcggc gtgccggtta tctgtcggcc ttgcgcgaag ccggtatcga cgccgatccg       660
     gcgctgctcg tggaatgccc gttcacgccc gacggcgggc ggcaggcggc gcgggcgttg       720
     ctcgcgctcg ccgagccgcc gaccgcgctg ctggtcgaca acaacatcgc gggcagcggc       780
     gcgtttcgcg tgctggtcga cagcgggctg cgcctcgggg cggacctgtc gctgatcgtc       840
     tatgacggcg tcccggccga tattgcgcac ccgtatcgcg tcacggcggt cgtgcagccg       900
     accgggcatg cgtcggggcg tgcgctcgcg gaactgatgc tgcggctgct ggacgacggc       960
     gtgtgcgatc aacggctcga agcgccggcc atcgaggcgg gcgacacgga cggtccgttg      1020
     cgcgggtag                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page