(data stored in ACNUC1104 zone)

EMBL: CP000959.PE63

CP000959.PE63        Location/Qualifiers
FT   CDS_pept        73069..74706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3248"
FT                   /product="Levanase"
FT                   /EC_number="3.2.1.65"
FT                   /note="KEGG: bam:Bamb_3697 levanase; PFAM: Glycosyl
FT                   hydrolase family 32 domain protein; SMART: glycoside
FT                   hydrolase family 32"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3248"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92404"
FT                   /db_xref="GOA:B1K8Q7"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8Q7"
FT                   /protein_id="ACA92404.1"
FT                   /translation="MNSTSFRFFVRLVRLLFACLACTQAVAAPCHAPPDNSTPQWRPAL
FT                   HYTPQRNWMNDPNGLVYANGRYHLFYQYNPLGNDWGNMSWGHATSTDLVHWREQPVAMR
FT                   ANATEEIFSGSIVADTLNTSGLGTPGHTPLVALYTSVYKPGSGHAPGIQAQSLAYSLDQ
FT                   GTTWQPYARNPVLTLDPESKEFRDPKVSWYAAGGYWLMTTVVADAHVVKLYRSDDLIHW
FT                   SFLSDFTLPDVPHAGALWEMPDLVPLPLDGDPRRIKWVMIVNVNPWSIAGGSGAMYFVG
FT                   NFDGRTFTPDRVAPAGSDPAQFRWVDHGADFYAAGTFSGAPGARPVAIAWMSNWDYAAK
FT                   VPTAPWRGATTLPRELALKTIDGEPTLIVAPAAAFDAWADGRPAVHEGDLTVDSATRAL
FT                   SAATRGVVQRITVTISPQRAARAGLIVRRSADGSIGTRIVYDTAKRTLTLDRAQSGEAN
FT                   FAGTFSREHIVDLPLEHGQLRLEIVVDRGSVEVFANGGRVALTDLIFPPLDADRVAVFA
FT                   EQGRATFAGLTVTQLKVGDDSRGACASR"
     atgaattcga cgtctttccg ctttttcgtc cggctcgtcc ggctgctgtt cgcctgcctg        60
     gcctgcacgc aggccgtggc cgctccgtgc cacgcgccgc ccgacaacag cacgccgcaa       120
     tggcggcccg ccctccacta cacgccgcaa cgcaactgga tgaacgatcc gaacgggctc       180
     gtctacgcga acggccgcta tcacctgttc tatcagtaca acccgctcgg caacgactgg       240
     ggcaacatgt cgtgggggca cgcgaccagc accgatctcg ttcactggcg cgagcagccg       300
     gtcgcgatgc gcgcgaacgc caccgaggaa atcttctcgg gctcgatcgt cgccgacacc       360
     ctgaacacgt ccggcctcgg cacgccgggc cacacgccgc tcgtcgcgct ttatacgagc       420
     gtctacaagc ccggctcggg tcacgcgccc ggcatccagg cgcaatcgct cgcgtacagc       480
     ctcgatcagg gcacgacctg gcagccgtat gcgcgcaacc cggtgttgac gctcgatccg       540
     gaatcgaagg agtttcgtga tccgaaagtg tcgtggtatg cggcgggcgg ctactggttg       600
     atgacgacgg tcgtcgccga tgcgcacgtc gtgaagctct atcgttccga cgacctgatc       660
     cactggtcgt tcctgagcga cttcacgctg cctgacgtgc cgcatgcggg cgcgctatgg       720
     gaaatgccgg atctcgtacc gttgccgctc gacggcgatc cccgccgcat caagtgggtg       780
     atgatcgtca acgtgaatcc gtggtcgatc gccggcggtt ccggcgcgat gtacttcgtc       840
     ggcaacttcg acggccgcac gtttacgccg gaccgcgtcg cacccgccgg ttcggacccc       900
     gcgcaattcc gctgggtcga tcacggcgcc gatttttacg cggccggcac gttctctggc       960
     gcaccgggcg cccggccggt cgcgatcgca tggatgagca actgggatta cgcggccaag      1020
     gtgccgaccg ccccgtggcg cggcgcgacc acgctgccgc gcgaactggc gctgaagacg      1080
     atcgacggcg agccgaccct catcgtcgcg ccagccgccg ccttcgacgc gtgggccgac      1140
     ggccggcccg cggtgcatga aggtgacctg acggtcgact ccgctacccg cgcgctatcg      1200
     gccgcgacgc gcggcgtcgt ccagcgcatc acggtgacga tctcgccgca gcgtgccgcg      1260
     cgcgcgggcc tgatcgtccg gcgctcggcc gacggctcga tcggtacccg gatcgtgtac      1320
     gacacggcga agcgcacgct gacgctcgac cgcgcgcaat ccggcgaagc gaatttcgcc      1380
     ggcacgttca gccgcgaaca catcgtcgat ctgccgctcg aacacgggca actgcggctc      1440
     gaaatcgtcg tcgatcgcgg ctcggtcgaa gtgttcgcca atggcggccg cgtggcgctg      1500
     acggacctga tctttccgcc gctcgacgcg gatcgcgtgg ccgtgttcgc agagcaaggc      1560
     cgcgcgacgt tcgcggggtt gacggtgacg cagttgaaag tcggcgacga ctcgcgcggc      1620
     gcctgtgcgt cgcgatag                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page