(data stored in ACNUC1104 zone)

EMBL: CP000959.PE69

CP000959.PE69        Location/Qualifiers
FT   CDS_pept        complement(79276..80496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3254"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bur:Bcep18194_B1748 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3254"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92410"
FT                   /db_xref="GOA:B1K8R3"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8R3"
FT                   /protein_id="ACA92410.1"
FT                   /translation="MKKRVAFAMTAVGLAAATAAHAQSSVTLYGIVDNGIAWQNNSSAV
FT                   GATSGGHSKVQMSTGVWAGSRFGLKGSEDLGGGTKAIFQLEAGVNTANGSSQWTNGIFT
FT                   RQAWVGLTNATYGTLTAGRQYTAYYTLLSPYSPTTWLTGYYGAHPGDIDSLDTSYRANN
FT                   SLVYMSPKFYGFTVGGSYSFGGVAGATNRGSTWSAAIQYLNGPAGIAVGYQKVNNSTLG
FT                   GGVWGANSTVQNGLTAAGDGNQPAVSSINNGYATAQSQQRIAVTAGYQFTPAWDISASY
FT                   SNVQYTPGTGSFFRNKAIFNTAGAVLHWKAAAQWDFAAGYSYTAATQSNGITSSAKYHQ
FT                   VTLSQYYSLSKRTGLYAVEAYQHASGNTLNGRGNAIISATTSIGDGVGAGSKQNQIGVG
FT                   VGMIHRF"
     atgaaaaagc gcgtcgcttt cgccatgacg gcagtcggtc tcgcagccgc taccgccgcc        60
     cacgcccaga gcagcgtgac cctgtacggt atcgtcgaca acggtatcgc ttggcagaac       120
     aactcgtcgg cagtcggcgc aacctcgggt ggtcactcga aggtgcagat gtccaccggc       180
     gtgtgggcag gcagccgctt cggcctgaag ggcagcgaag atctcggcgg cggcacgaag       240
     gcgattttcc agttggaagc cggcgtcaac acggctaacg gctcgtcgca gtggaccaac       300
     ggcatcttca cgcgtcaggc atgggttggc ctgaccaacg ccacgtacgg tacgctgacg       360
     gccggccgcc agtacaccgc gtactacacg ctgctgtcgc cgtacagccc gacgacctgg       420
     ctgaccggtt actacggcgc gcacccgggc gatatcgatt cgctggatac cagctaccgc       480
     gcgaacaact cgctcgtcta catgtcgccg aagttctacg gcttcacggt cggcggttcg       540
     tactcgttcg gcggcgtcgc gggcgcgacg aaccgcggct cgacgtggag cgcggcgatc       600
     cagtacctga acggcccggc aggcatcgcg gtcggctatc agaaggtcaa caactcgacg       660
     ctcggcggcg gcgtgtgggg cgcgaactcg acggtccaga acggcctgac ggcagcaggc       720
     gacggcaacc agccggcagt ctcgtcgatc aacaacggct acgcgaccgc gcaatcgcag       780
     cagcgtatcg ccgtgacggc gggctaccag ttcacgccgg catgggatat ttcggcgtcg       840
     tactcgaacg tccagtacac gccgggcacg ggttcgttct tccggaacaa ggcaatcttc       900
     aacacggctg gcgccgtgct gcactggaag gcagctgctc agtgggactt cgcggcaggc       960
     tactcgtaca cggccgcaac gcagtcgaac ggcatcacga gctcggccaa gtaccaccag      1020
     gtcacgctgt cgcagtacta cagcctgtcg aagcgcacgg gcctgtacgc ggttgaggct      1080
     taccagcacg caagcggcaa cacgctgaac ggccgcggca acgcaatcat ctcggcgacc      1140
     acgtcgatcg gtgacggcgt gggcgcaggt tcgaagcaga accagatcgg cgtcggcgtc      1200
     ggcatgatcc accgcttcta a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page