(data stored in ACNUC1104 zone)

EMBL: CP000959.PE74

CP000959.PE74        Location/Qualifiers
FT   CDS_pept        86016..86939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3259"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B1753
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3259"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92415"
FT                   /db_xref="GOA:B1K8R8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8R8"
FT                   /protein_id="ACA92415.1"
FT                   /translation="MKISDIDAFAAVVRCQTLSQAAAELGMTQPAITRRVQNLEEALGV
FT                   TLLDRNTKPPRPTDIGRQVFEQCRAILREVDALRELTAGQQPPAGEFRIGLTQGLGELM
FT                   LPALIGDLAAQWPALATQVTTAWGGLLVERIARRELDAALVFLAREMVLPAQVEGVRLL
FT                   DTRLVAVGRKGDWPRRSYRLADCHARGWVLNPDGCGFRAGLRRALDAQGLPMPVTLDAY
FT                   GRDLQLQSVANGFGLGLMPLPLVEGSPLRDALDIVPLADFRPQIDLWLLRRHDAARFDA
FT                   PLAAIAAHARAAFALPERSHDKAKAA"
     atgaaaatta gcgatatcga cgcttttgca gcggtcgtcc gctgccagac cctgagccag        60
     gccgcggccg agctcgggat gacgcagccc gcgatcacgc ggcgcgtcca gaatctcgag       120
     gaagcgctcg gcgtgacgct gctcgaccgc aacacgaagc cgccgcgccc gaccgacatc       180
     ggccggcagg tattcgaaca gtgtcgcgcg atcctgcgcg aggtcgacgc gctgcgcgaa       240
     ctgacggccg gccagcagcc gccggccggc gaattccgga tcgggctcac gcaggggctc       300
     ggcgagctga tgctgccggc gctcatcggc gatctcgctg cgcaatggcc cgcgctcgcg       360
     acgcaggtca cgaccgcatg gggcggcctg ctcgtcgaac gcatcgcccg ccgcgaactc       420
     gatgcggcgc tggtcttcct cgcccgcgaa atggtgctgc cggcgcaggt cgaaggcgtt       480
     cggctgctgg acacgcggct cgtcgcggtc ggccgcaagg gcgactggcc gcgccgcagc       540
     taccggctcg ccgattgcca cgcgcgcggc tgggtgctca atccggacgg ctgcggcttt       600
     cgtgcgggcc tgcggcgcgc gctcgacgcg cagggcctgc cgatgccggt cacgctcgac       660
     gcgtacggcc gcgacctgca actgcagagc gtcgcgaacg gcttcggcct cgggctgatg       720
     ccgctgccgc tcgtcgaagg cagcccgctg cgcgacgcgc tcgacatcgt gccactcgcc       780
     gatttcaggc cgcagatcga tctgtggctg ctgcgccggc acgatgcggc ccgtttcgac       840
     gcgccgctcg cggccatcgc cgcgcatgcg cgcgccgcgt tcgcgctgcc cgagcgatcg       900
     cacgacaagg ccaaggccgc ttga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page