(data stored in ACNUC1104 zone)

EMBL: CP000959.PE80

CP000959.PE80        Location/Qualifiers
FT   CDS_pept        92773..93594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3265"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B1759 ABC nitrate/sulfonate/bicarbonate
FT                   family transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3265"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92421"
FT                   /db_xref="GOA:B1K8S4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8S4"
FT                   /protein_id="ACA92421.1"
FT                   /translation="MVSAAVLEPAAATAAAPAVTPPRGARIDIRRVSHAFDGPGGALPV
FT                   LDDVSLSVAAGEFVALLGPSGCGKSTLLRLVAGLDAARQGTIAQDGVPIERPDPSRIVV
FT                   FQDPTLYPWRRVRANVALGLEARGVARTAQHRVDDALARVGLQEFANVFPHQLSGGMAQ
FT                   RVALARALVNDPHLLILDEPLGKLDSLTRLTMQAELTALWQRDGFSALLVTHDVEEALF
FT                   LAQRVIVFGPRPATIVAELRVDLPYPRHRGDPRLAELRHDALRHLGLDASW"
     atggtaagcg ccgccgtact cgaaccggcc gcggccactg ccgcggcgcc cgccgtcacg        60
     ccgccgcgcg gcgcgcgcat cgacatccgc cgcgtgagcc atgcgttcga cggccccggc       120
     ggcgcgctgc cggtgctcga cgacgtgtcg ctgtcggtcg cggccggcga attcgtcgcg       180
     ctgctcggcc cgagcggctg cgggaaatcg acgctgctgc gcctcgtcgc ggggctcgac       240
     gccgcacggc aaggcaccat cgcgcaggat ggcgtgccga tcgagcgccc cgatccgtcg       300
     cgcatcgtcg tgttccagga cccgacgctg tacccgtggc ggcgcgtgcg cgcgaacgtc       360
     gcgctcggcc tcgaagcacg cggcgtggcg cgtaccgcgc agcatcgcgt cgacgatgcg       420
     ctcgcgcgcg tcgggctgca ggagttcgcg aacgtgtttc cgcatcagtt gtccggcggg       480
     atggcgcagc gcgtcgcgct cgcccgcgcg ctcgtcaacg atccgcacct gctgatcctc       540
     gacgagccgc tcggcaagct cgattcgctg acgcggctca cgatgcaggc cgagctgacc       600
     gcgctgtggc aacgcgacgg tttctccgcg ctgctcgtca cgcacgacgt ggaagaagcg       660
     ctgttcctcg cgcagcgcgt gatcgtgttc gggccgcgcc cggcaacgat cgtcgccgaa       720
     ctgcgtgtcg acctgcccta tccgcgccat cgcggcgacc cgcgcctcgc cgaattgcgg       780
     cacgacgcgc tgcggcatct cgggctcgat gcgagctggt ag                          822
//

If you have problems or comments...

PBIL Back to PBIL home page