(data stored in ACNUC1104 zone)

EMBL: CP000959.PE81

CP000959.PE81        Location/Qualifiers
FT   CDS_pept        93645..94829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3266"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG:
FT                   bur:Bcep18194_B1760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3266"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92422"
FT                   /db_xref="GOA:B1K8S5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8S5"
FT                   /protein_id="ACA92422.1"
FT                   /translation="MNAPPFADWAIAFLQLLYRAQIALARGLHAIGLTGDADGQAAWPW
FT                   AHRIALETLRIDAGLTRQLALACGATALAVVLACTALASRKWRIASASAALAVAWFAPW
FT                   PPAALWLAPAVPTSFQRDPAPFSVSNVMRGAHLYTQHCAACHGADGRGEGPLAATLAHW
FT                   PPTFAGALLARRLDGELFWRVRHGTQDEHGASTMPGFAATLGPQDTWAVLDYLKALAAG
FT                   SGAQAEGAWPVPVPLPALDVRCGDAAPQALEHWREGQRVRVVALAPGATPPPEDARWQT
FT                   LLVTENGVSVPSSTGSRANCVATTADAWRAFATIAGVAPDALGGTQLLADRRGWLRARA
FT                   LPGSAGWSDADLLCRSDTAAVRPSKPTARGDALTALLLRVDREPVRDVQAGLPH"
     atgaacgcgc cgccgttcgc cgactgggcc atcgcgttcc tgcaactgct gtatcgcgcg        60
     caaatcgcgt tggcgcgtgg gctgcatgcg atcggcctga ccggcgatgc cgacggccaa       120
     gccgcgtggc cgtgggcgca tcgcattgcg ctcgagacgc tgcgcatcga cgcggggctc       180
     acgcggcagc tcgcgctcgc ctgtggcgcg acggcgctgg ccgtcgtgct cgcgtgcacc       240
     gcgctggctt cgcgcaagtg gcgtatcgcg tcggccagcg ccgcgctggc cgtcgcgtgg       300
     ttcgcgccat ggccgcccgc tgcgctgtgg ctcgcgccgg ccgtgccgac cagctttcag       360
     cgcgatcccg cgccgttttc cgtgtcgaac gtgatgcgcg gcgcgcacct gtacacgcaa       420
     cattgcgctg cctgccacgg cgcggacgga cgcggcgaag ggccgctcgc ggccacgctc       480
     gcgcactggc cgccgacctt cgccggcgcg ctgctcgcgc gccgcctcga cggcgaactg       540
     ttctggcgcg tgcgccacgg cacgcaggac gagcacggcg cgtcgacgat gcccggcttc       600
     gcggcgacgc tgggcccaca ggacacctgg gccgtgctcg actacctgaa agcgctggcc       660
     gccggcagcg gcgcgcaggc ggaaggcgcg tggccggtgc cggtcccgct gccggccctc       720
     gacgtgcggt gcggtgacgc cgctccccag gcgctagagc actggcgcga aggccagcgc       780
     gtgcgcgtcg tcgcgcttgc gcccggcgcg acgccaccgc cggaagacgc gcgctggcag       840
     accttgctgg tcaccgaaaa cggggtgtcg gtgccatcgt cgaccggctc gcgtgcgaac       900
     tgcgtcgcga cgaccgccga tgcgtggcgt gcgttcgcga cgattgccgg cgtcgcaccc       960
     gatgcgctcg gcggcacgca actgcttgcg gatcgacgcg gctggctgcg cgcgcgtgcg      1020
     ttgccgggca gcgccggctg gtcggacgcc gacctgctgt gccgctcgga tacggcggca      1080
     gtgcggccgt ccaagccgac cgcccgcggc gacgcgctaa ccgcactgct gctgcgcgtc      1140
     gatcgggaac ccgtgcgcga cgtacaagcc gggctcccgc attga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page