(data stored in ACNUC1104 zone)

EMBL: CP000959.PE82

CP000959.PE82        Location/Qualifiers
FT   CDS_pept        94863..95816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3267"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; KEGG:
FT                   bur:Bcep18194_B1761 ABC transporter, substrate-binding
FT                   protein, aliphatic sulphonates"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3267"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92423"
FT                   /db_xref="GOA:B1K8S6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8S6"
FT                   /protein_id="ACA92423.1"
FT                   /translation="MNPTRRHFLAQASALATIAAAPAVVRAQSGARPLLRAGDQKGGLR
FT                   ALLEAAGELNGLAYDIAWTEFPAAAPLAEALNAAAVDCGPIGDAPVIFALASGARIKVI
FT                   GANRSDPYGTAVLVQPDAALKGAADLKGKRIGTTRGSIGHFVTLKALDAAGLPPDAVSF
FT                   RFLPPADTMLALATGSIDAWATWEPYTALAETSGRARVLVNGRGLWSGLSYLAATDAAI
FT                   ASKRDVLHDFLRRVVRAQAWSYRHVDAYSAALARIIGIPPAAAKLQFERRGTRWLPIDA
FT                   TVIAEQQRTADFYLKAGLLRQPLDVRTTFDTGFPLG"
     atgaatccga cccgacgcca cttcctcgcc caggcgagcg cccttgccac gatcgccgcc        60
     gcccccgccg tcgtgcgcgc gcaatcgggc gcacgcccgc tgctgcgcgc cggcgaccag       120
     aaaggcgggc tgcgcgcact gctcgaagcg gccggcgaac tgaacggcct cgcgtacgac       180
     atcgcgtgga ccgaatttcc ggccgccgcg ccgctcgccg aagcgctgaa cgcagccgcc       240
     gtcgactgcg ggccgatcgg cgacgcgccg gtgatcttcg cgctggcatc gggcgcccgc       300
     atcaaggtga tcggcgcgaa ccgttccgat ccgtacggca cggccgtgct cgtgcaaccc       360
     gacgccgcgc tgaaaggcgc ggccgacctg aaaggcaagc gcatcggcac cacgcgcggc       420
     tcgatcggcc atttcgtcac gctgaaggcg ctcgacgcgg ccggcctgcc gcccgatgcc       480
     gtgtcgttcc gcttcctgcc gccggccgac acgatgctgg cgctcgccac cggttcgatc       540
     gacgcatggg cgacctggga gccctatacc gcgctcgccg aaacgagcgg tcgtgcgcgc       600
     gtgctggtca acggccgcgg gctgtggtcc gggctcagct atctggcggc gaccgacgcg       660
     gcgatcgcgt cgaagcgcga cgtgctgcac gatttcctgc ggcgcgtcgt gcgcgcgcag       720
     gcctggtcgt accggcacgt cgacgcgtat tcggcggcgc tcgcgcgcat catcggcatt       780
     ccgccggccg ccgcgaagct gcaattcgag cgccgcggca cccgctggct gccgatcgac       840
     gcgacggtga tcgccgaaca gcagcgcacg gccgacttct acctgaaggc cgggctgctg       900
     cgccagccgc tcgacgtgcg cacgaccttc gacacgggct tcccgctcgg ctga             954
//

If you have problems or comments...

PBIL Back to PBIL home page