(data stored in ACNUC1104 zone)

EMBL: CP000959.PE84

CP000959.PE84        Location/Qualifiers
FT   CDS_pept        complement(96834..98258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3269"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; Two-component sensor kinase domain
FT                   protein; KEGG: bur:Bcep18194_B1763 periplasmic sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3269"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92425"
FT                   /db_xref="GOA:B1K8S8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8S8"
FT                   /protein_id="ACA92425.1"
FT                   /translation="MTRPNLRAQVALWLLLPLLGLLALDSWLTYQRAMSAAHVAFDRTL
FT                   SSSLKSIREGVRLNDGEIEVDLPYLALEMLESSDGGKIYYLIREDNGHTITGYPDLPLP
FT                   QGRDAGDGALFVTRYYDVVYRGEQLRMAALRIPVHDVPTAQSRIVWVMVGETIEARQAL
FT                   AREILIGSLLQEGLLVVLALGIVWLGVGRGLRPLNRLSATVAARSEDDTTPLDTGAMPS
FT                   ELAPLVDSINQYIGRTQRMQVARRRFFADAAHQLKTPLAAVQAGVELALRPDEQPRANV
FT                   HLRRANGAVRQAAKIVQQLLSLSRLDSDSGHAVAHKPVALHRLARSVTLDWSPVARARD
FT                   IDLGFEHEADVDVLGQSDLLGEMVGNLIDNAIRYAGDRAVITVRVSRDGADARLDVIDN
FT                   GPGIPADERDAVFERFHRGSKTQTVEGTGLGLSIVREIARVHQGSVTLADAAGGGLIVT
FT                   IRLPAAAASDAMPRAA"
     atgacccgcc cgaacctgcg cgcgcaggtc gcgctgtggc tgctgctgcc gctgctcggc        60
     ctgctcgcgc tcgactcgtg gctcacgtac cagcgtgcga tgagcgccgc gcacgtcgcg       120
     ttcgaccgca cgctgtcgtc gtcgctgaaa tcgatccgcg aaggcgtgcg gctcaacgac       180
     ggcgagatcg aggtcgacct gccgtatctc gcgctcgaaa tgctcgaatc gagcgacggc       240
     ggcaagatct actacctgat ccgcgaggac aacggccaca cgatcaccgg ctatccggac       300
     ctgccgctgc cgcagggccg cgacgcgggc gacggcgcgc tgttcgtcac gcgctactac       360
     gacgtcgtgt atcgcggcga gcaattgcgg atggcggcgc tgcgcatccc ggtgcacgac       420
     gtgccgaccg cgcagtcgcg catcgtgtgg gtgatggtcg gggagacgat cgaggcgcgc       480
     caggcgctcg cgcgcgagat cctgatcggg tcgctgctgc aggaggggct gctggtcgtg       540
     ctggcgctcg ggatcgtgtg gctcggcgtc ggccgcgggc tgcggccgct gaaccggctg       600
     tcggccaccg tcgccgcgcg cagcgaggac gacacgacac cgctcgacac cggcgcgatg       660
     ccgagcgagc tcgcgccgct cgtcgattcg atcaaccagt acatcggccg cacgcagcgg       720
     atgcaggtgg cgcggcggcg cttcttcgcc gatgcggccc atcagttgaa gacgccgctc       780
     gcggccgtgc aggcgggcgt cgaactcgca ctgcggccgg acgagcagcc gcgcgcgaac       840
     gtgcatctgc ggcgcgcgaa cggtgcggtg cggcaggccg cgaagatcgt ccagcaactg       900
     ctgtcgctgt cgcggctcga ttcggacagc ggccatgcgg tcgcgcacaa gccggtcgcg       960
     ctgcaccggc tcgcgcgcag cgtgacgctc gactggtcgc ccgtcgcgcg cgcacgcgac      1020
     atcgatctcg gcttcgagca cgaggccgac gtcgacgtgc tcgggcagtc cgacttgctc      1080
     ggcgaaatgg tcggcaacct gatcgacaac gcgatccgtt atgcgggcga ccgtgcggtg      1140
     atcacggtgc gcgtctcgcg cgacggcgcg gacgcgcggc tcgacgtgat cgacaacggg      1200
     ccgggcattc cggccgacga acgcgacgcg gtgttcgagc gcttccatcg cggcagcaag      1260
     acgcagacgg tcgaaggaac ggggctcggg ttgtcgatcg tgcgggaaat cgcgcgtgtg      1320
     catcagggca gcgtgacgct ggccgatgcg gccggcggcg ggctgatcgt gacgatccgg      1380
     ctgccggcgg cggcggcgag cgatgcgatg ccgcgcgccg cgtga                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page