(data stored in ACNUC1104 zone)

EMBL: CP000959.PE85

CP000959.PE85        Location/Qualifiers
FT   CDS_pept        complement(98255..98929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3270"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bur:Bcep18194_B1764 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3270"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92426"
FT                   /db_xref="GOA:B1K8S9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8S9"
FT                   /protein_id="ACA92426.1"
FT                   /translation="MRVLLVEDNPNLAQSLNDALSAARFAVDHMADGEAADHVLRTQDY
FT                   ALVILDLGLPKLDGLEVLRRLRARRNPVPVLILTAHGSVEDRVKGLDLGADDYLAKPFE
FT                   LTELEARARALIRRSLGHEHSRVECGPLSYDSIDRSFHLAGEPLSLTPRERSVLEVLIL
FT                   RNGRAINKDTLSEKIFGLDESVNADAIEIYVYRLRKKLENTGVAIVTLRGLGYLLEAKA
FT                   EE"
     atgcgtgtgc tgctcgtcga agacaacccg aacctggccc agtcgctgaa cgacgcgctg        60
     agcgccgcgc gcttcgcggt cgatcacatg gccgacggcg aggcggcgga ccacgtgctg       120
     cgcacgcagg attacgcgct ggtgattctg gacctcgggc tgccgaaact ggacgggctc       180
     gaggtgctgc gacggctgcg cgcgcgccgc aacccggtgc cggtgctgat cctcaccgcg       240
     cacgggtcgg tcgaggaccg cgtgaagggg ctcgatctcg gcgccgacga ctatctcgcg       300
     aagccgttcg agctgaccga actcgaggcg cgcgcccgcg cgctgatccg gcgcagcctc       360
     gggcacgagc attcgcgcgt cgagtgcggg ccgctttcgt acgacagtat cgaccgcagc       420
     tttcatctcg cgggcgagcc gctgtcgctc acgccgcgcg agcgctcggt gctcgaggtg       480
     ctgatcctgc gcaacggtcg cgcgatcaac aaggacacgc tgtcggagaa gatcttcggg       540
     ctcgacgaat cggtcaacgc ggacgcgatc gagatctacg tgtaccggtt gcgcaagaag       600
     ctggagaaca cgggcgtcgc gatcgtcacg ctgcgcggcc tgggctatct gctcgaagcg       660
     aaggcggaag aatga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page