(data stored in ACNUC1104 zone)

EMBL: CP000959.PE87

CP000959.PE87        Location/Qualifiers
FT   CDS_pept        100373..101854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3272"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bur:Bcep18194_B1766 transcriptional
FT                   regulator, GntR family with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3272"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92428"
FT                   /db_xref="GOA:B1K8T1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8T1"
FT                   /protein_id="ACA92428.1"
FT                   /translation="MSRGKAAIPLDLPRPAGLSGGSPHSKQECIADTIRDAILKRLLPG
FT                   DSPLPSSRTLAARWDIARGTVEAAYDVLCAEGYIARTQGSGTRVCAVVPDSYLRAAARS
FT                   RDGSPLPATLASPASTAPAEPEHGVRPGVPFVARLADPGLLPIQQWKKALGASLLAATA
FT                   DDLGATPAQGVESLRAEIAAYLREYRGIPCEAGDIVITTGIRHAIDLVARTLLAPGSTV
FT                   LMEDPGYASAWQIFTIAGATVIDVPVDREGIDTASLNRHPDARAAYVTPAHQAPLGVTM
FT                   SVSRRLELLDWAQRNRTWIIEDDYDGEFSYQTAPLPALKSLDACDRVIYCGSFNKTLFS
FT                   GLRIGFMIVPAELRPALSAVWHATARSVGVAPQLALARFIGQGDFAKHLRAARHAYRQR
FT                   RDIVLDQLEKHARGRYSVTGEHAGFHFVLWLPPGIDDATYVAQARAAGIELQPVRGFCR
FT                   SARREAGVVVGYAALTAAHARHGGRLLGQLLATSA"
     atgtcgcgag gcaaagccgc gattccgctg gacctgccgc gccctgccgg gctgtcgggc        60
     ggcagcccgc actcgaagca ggaatgcatc gccgacacga ttcgcgacgc gatcctgaaa       120
     cgcctgctgc ccggcgacag tccgctgccc tccagccgga cgctggccgc gcgctgggac       180
     atcgcgcgcg gcaccgtcga agcggcgtac gacgtcctgt gcgccgaggg ctacatcgcc       240
     cgcacgcaag ggtccggcac acgcgtgtgc gcggtggtgc cggacagcta tctgcgcgcg       300
     gccgcgcggt cgcgagacgg cagcccgctc cccgccaccc tcgcgtcccc cgcatccacc       360
     gccccggccg agcccgagca cggcgtgcgt ccgggcgtcc cgttcgtcgc gcggctcgcc       420
     gaccccggcc tgctgccgat ccagcaatgg aagaaggcgc tcggcgccag cctgctcgcc       480
     gcgacagcgg acgacctcgg cgcgacaccg gcacagggcg tcgaaagcct gcgcgccgag       540
     atcgccgcgt acctgcggga ataccgcggc atcccgtgcg aggccggcga catcgtcatc       600
     acgaccggca tccgccacgc gatcgacctc gtcgcacgca cgctgctcgc acccggctcg       660
     acggtgctga tggaagaccc cggctatgcg tcggcgtggc agatcttcac gatcgcgggc       720
     gcgaccgtga tcgacgtgcc ggtcgatcgg gaaggcatcg acaccgcatc gctgaatcgc       780
     catcccgatg cgcgcgccgc gtacgtgacg cccgcccatc aggcgccgct cggcgtcacg       840
     atgtcggtct cgcgccggct cgaactgctc gactgggcgc agcgcaaccg cacgtggatc       900
     atcgaggacg actacgacgg cgaattcagc taccagaccg ccccgctgcc cgcgctgaaa       960
     tcgctcgacg cgtgcgaccg cgtgatctat tgcgggtcgt tcaacaagac gctgttttcc      1020
     gggctgcgca tcggcttcat gatcgtgccg gcggaactgc ggccggcgct gtccgccgtg      1080
     tggcacgcga ccgcgcgttc ggtcggcgtc gcgccgcaac tggcgctggc ccgcttcatc      1140
     ggtcaaggcg atttcgcgaa gcacctgcgc gccgcccgcc acgcgtaccg ccagcggcgc      1200
     gacatcgtgc tcgaccagct cgagaaacat gcccgcggcc gctactcggt gaccggcgag      1260
     cacgcgggct ttcatttcgt gctgtggctg ccgcccggca tcgacgacgc aacgtatgtc      1320
     gcgcaagccc gcgcggccgg catcgagctg caaccggtcc gcggcttctg tcgaagcgcc      1380
     cgccgcgaag cgggcgtggt cgtgggctat gccgcgctga cggccgccca cgcgcggcat      1440
     ggcggccgcc tcctcggcca actgctggcc acttccgcgt ag                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page