(data stored in ACNUC1104 zone)

EMBL: CP000959.PE88

CP000959.PE88        Location/Qualifiers
FT   CDS_pept        102048..103148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3273"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bur:Bcep18194_B1767 ABC Fe3+ siderophore transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3273"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92429"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8T2"
FT                   /protein_id="ACA92429.1"
FT                   /translation="MPFAPKHLAAALAIVLGTAAGSAAAQVPAGYPGNYQGVIDAAKKE
FT                   GKLIVYSTTDTGLVRPLIKDFESLYGVKVEYNDMNSTELYNRYISENAASSTSADVLWS
FT                   SAMDLQVKLVNDGLMASYDSPESPNVPQWAQYQKQAYGTTFEPLAIVYNKRLIPENEVP
FT                   TTRADLIKLLTTQADKFKGKVTTYDIEKSGVGFNYLTQDAHVNEKVTWELVKAIGATGP
FT                   KLQSSTGAMMERISSGENLIGYNIIGSYAYAKAKKDKSIGYVFPKDYTQVVSRLATVSK
FT                   KAKNPNAAKLWVDYLLSKRGQTLIANQANLYAIRADVTGETSAASLTKELGDSLKPIQI
FT                   GTGLLVYLDQSKRLAFLKQWQQAIKR"
     atgccgtttg caccgaagca cctcgccgcc gcgctggcga tcgttctggg cactgccgcc        60
     ggcagcgccg ccgcgcaggt tccggccggc tacccgggga actatcaggg cgtgatcgac       120
     gccgcgaaga aggaaggcaa gctgatcgtc tactcgacga ccgacacggg cctcgtgcgt       180
     ccgctgatca aggacttcga aagcctgtac ggcgtgaagg tcgagtacaa cgacatgaac       240
     agcaccgagc tgtacaaccg ctacatcagc gagaacgcgg cgagcagcac cagtgccgac       300
     gtgttgtgga gttcggcgat ggatctgcag gtcaagctcg tcaacgacgg cctgatggca       360
     tcctacgatt cgcccgaaag cccgaacgtg ccgcagtggg cgcagtacca gaagcaggcg       420
     tacggcacga cgttcgagcc gctcgcgatc gtctacaaca agcggctgat ccccgagaac       480
     gaagtgccga cgacgcgcgc cgacctgatc aagctgctca ccacgcaggc cgacaagttc       540
     aagggcaagg tcacgaccta cgacatcgag aaatcgggcg tcggcttcaa ctatctgacc       600
     caggacgcgc acgtgaacga gaaagtcacg tgggaactcg tcaaggcgat cggcgcgacc       660
     ggcccgaagc tgcagtcgag cacgggcgcg atgatggagc gcatctcgtc gggcgagaac       720
     ctgatcggct acaacatcat cggttcgtat gcctacgcaa aggcgaagaa ggacaagtcg       780
     atcggctacg tgtttccgaa ggactacacg caggtcgtga gccgtctcgc cacggtgtcg       840
     aagaaggcga agaacccgaa cgccgcgaag ctgtgggtcg actacctgct gtccaagcgc       900
     ggccagacgc tgatcgcgaa ccaggcgaac ctgtacgcga tccgcgcgga cgtgaccggc       960
     gaaacgtcgg ccgcgagcct cacgaaggaa ctcggcgatt cgctgaagcc gatccagatc      1020
     ggcaccggcc tgctggtcta tctcgaccag tcgaagcgcc tcgcgttcct gaagcaatgg      1080
     cagcaggcga tcaagcgctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page