(data stored in ACNUC1104 zone)

EMBL: CP000959.PE90

CP000959.PE90        Location/Qualifiers
FT   CDS_pept        105022..106089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3275"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B1769 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3275"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92431"
FT                   /db_xref="GOA:B1K8T4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8T4"
FT                   /protein_id="ACA92431.1"
FT                   /translation="MDKLIVDDLHLSYGANPILKGVSFELKAGEVVCLLGASGSGKTTL
FT                   LRAVAGLEQPSNGGIQLDDRVFFDGARRVDLPVEQRSLGLVFQSYALWPHRTVADNVGY
FT                   GLKLRRVAPAEQKRRVQTALDQLGLGHLAERFPHQLSGGQQQRVAIARALVYNPPVILL
FT                   DEPLSNLDAKLREEARAWLRELIVSLGLSALCVTHDQTEAMAMSDRILLLRNGRIEQEG
FT                   TPAELYGAPRSLYTAEFMGSNNRIDARVAAIDGECVTLAGDGWQLQALARDTLAPGQDA
FT                   QAVIRLERVQVTDGPGANRLQADLVTSMYLGDRWEYLFHCGEMRLRAFGHVPRAAGKHW
FT                   IEFPTNDCWAFAKAG"
     atggataagc tcatcgtcga cgatctgcac ctcagctacg gcgccaaccc gatcctcaag        60
     ggcgtgtcgt tcgaactgaa ggccggcgaa gtcgtgtgcc tgctcggcgc gtcgggcagc       120
     ggcaagacca cgctgctgcg tgcggtggcc ggcctcgaac agccgtccaa cgggggcatc       180
     cagctcgacg accgcgtgtt cttcgacggc gctcggcgcg tcgacctgcc ggtcgaacag       240
     cgctcgctcg gcctcgtgtt ccagtcgtac gcgctgtggc cgcaccgcac cgtcgccgac       300
     aacgtcggct atggcctcaa gctgcgccgt gtcgcaccgg ccgaacagaa gcgccgcgtg       360
     cagaccgcgc tcgaccagct cggcctcggc catctcgccg aacgctttcc gcatcagctg       420
     tcgggcggcc agcagcagcg cgtcgcgatt gcccgcgcgc tcgtctacaa cccgccggtg       480
     atcctgctcg acgagccgct gtcgaacctc gacgcgaagc tgcgcgagga agcgcgtgcg       540
     tggctgcgcg agctgatcgt gtcgctcggg ctgtcggccc tgtgcgtgac gcacgaccag       600
     accgaagcga tggcgatgtc cgatcgcatc ctgctgctgc gcaacggccg catcgagcag       660
     gaaggcacac cggccgagct gtacggcgcg ccgcgctcgc tgtacaccgc cgaattcatg       720
     ggcagcaaca accggatcga cgcgcgcgtc gccgcgatcg acggcgaatg cgtgacgctc       780
     gccggcgacg gctggcaact gcaggcgctt gcccgcgaca cgctggcacc cggccaggac       840
     gcccaggccg tgattcgcct cgaacgcgtg caggtcactg acggcccggg cgcgaaccgc       900
     ctgcaggccg acctcgtcac gtcgatgtat ctcggcgatc gctgggagta cctgttccat       960
     tgcggcgaaa tgcgcctgcg tgcgttcggc catgtaccgc gcgcggccgg caagcactgg      1020
     atcgaattcc cgaccaacga ctgctgggcg ttcgcgaaag cgggctga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page