(data stored in ACNUC1104 zone)

EMBL: CP000959.PE93

CP000959.PE93        Location/Qualifiers
FT   CDS_pept        complement(108472..108723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3278"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92434"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8T7"
FT                   /protein_id="ACA92434.1"
FT                   /translation="MRAEQMLPDHANQVDAGGTTIRKGTVGAFLVNARVLTDPNAAPAE
FT                   RARAEADAIDALPALRALGLFDVLEVRDPALRAWLDVR"
     atgcgagccg aacagatgct tcccgaccat gccaaccaag tcgatgccgg cggaacgacg        60
     atccgcaagg ggaccgtcgg cgcgtttctg gtcaatgcgc gtgtattgac cgatccgaac       120
     gccgcgccgg ccgagagggc gcgcgcggag gccgatgcga tcgacgcgtt gcctgcactg       180
     cgtgcgctcg gcctgttcga cgtgctggaa gtacgcgatc ccgcgctgcg cgcatggctc       240
     gatgtccgat aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page