(data stored in ACNUC1104 zone)

EMBL: CP000959.PE98

CP000959.PE98        Location/Qualifiers
FT   CDS_pept        complement(111766..112614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3283"
FT                   /product="3,4-dihydroxyphenylacetate 2,3-dioxygenase"
FT                   /EC_number="1.13.11.15"
FT                   /note="KEGG: bur:Bcep18194_B1780 3,4-dihydroxyphenylacetate
FT                   2,3-dioxygenase HpaD_Fe; TIGRFAM:
FT                   3,4-dihydroxyphenylacetate 2,3-dioxygenase; PFAM: Extradiol
FT                   ring-cleavage dioxygenase class III protein subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3283"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92439"
FT                   /db_xref="GOA:B1K8U2"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR011984"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8U2"
FT                   /protein_id="ACA92439.1"
FT                   /translation="MGKLSLAAKITHVPSMYLSELPGKHHGCREAAIRGHQLIGERCRA
FT                   LGVDTIVVSDVHWLVNAGYHVNCNARFAGTYTSNELPHFIRDMQYAYPGNPALGRLIAE
FT                   TATERGVATRAHEIDSLELEYGTLVPMRYMNGDQHFKVVSIAGWCMWHQLDESRRFGEA
FT                   LLEAIEKSDSNVAFLASGSLSHRFNDNGSPEESIHQISREFFRQVDLRVVELWKQGDFK
FT                   TFCAMLPEYNTHCHGEGGMHDTAMLLGLLGWDRYDKPVEIVTDYFASSGTGQINAIFPL
FT                   P"
     atgggcaaac tgtccctcgc cgcgaagatc acgcacgtgc cgtcgatgta cctgtcggaa        60
     ctgcccggca agcatcacgg ctgccgtgaa gcggcgatcc gcggccacca gctgatcggc       120
     gagcgctgcc gcgcgctcgg cgtcgacacg atcgtcgtgt cggacgtgca ctggctcgtc       180
     aacgccggct atcacgtgaa ctgcaatgcg cggttcgcgg gcacctatac gagcaacgag       240
     ctgccgcatt tcatccgcga catgcagtac gcgtatccgg gcaacccggc gctcggccgg       300
     ctgatcgcgg aaacggccac cgagcgcggc gtcgcgacgc gtgcgcacga aatcgacagc       360
     ctcgagctcg aatacggcac gctcgtgccg atgcgctaca tgaacggcga ccagcacttc       420
     aaggtcgtgt cgattgccgg ctggtgcatg tggcatcagc tcgacgaaag ccggcgcttc       480
     ggcgaggcgc tgctcgaggc gatcgagaag agcgattcga acgtcgcgtt ccttgcgagc       540
     ggttcgctgt cgcaccgctt caacgacaac ggcagccccg aggaatcgat tcaccagatc       600
     agccgcgaat tcttccggca ggtcgacctg cgcgtggtcg agctgtggaa gcagggcgat       660
     ttcaagacct tctgcgcgat gctgcccgaa tacaacacgc attgccacgg cgaaggcggc       720
     atgcacgaca cggcgatgct gctcgggctg ctcggctggg atcgctacga caaaccggtc       780
     gagatcgtca ccgactattt cgcgagctcc ggcaccgggc agatcaacgc gatcttcccg       840
     ctgccctga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page