(data stored in ACNUC7421 zone)

EMBL: CP001022.PE10

CP001022.PE10        Location/Qualifiers
FT   CDS_pept        18784..19674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0010"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein; thiazole biosynthesis
FT                   family protein; KEGG: bcl:ABC0451 pyridoxine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59498"
FT                   /db_xref="GOA:B1YGC1"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGC1"
FT                   /protein_id="ACB59498.1"
FT                   /translation="MMERQQGSDRVKRGMAEMQKGGVIMDVVNAEQAKIAEAAGAVAVM
FT                   ALERVPSDIRRDGGVARMADPLITEEVLQAVSIPVMAKCRIGHIVEARVLESLGVDFID
FT                   ESEVLTPADEEYHLLKSSFTVPFVCGARDLGEAARRIAEGAAMIRTKGEPGTGNVVEAV
FT                   RHMRKIQAQLHQILHSQPDELMTRAKEWGASYEVLQQIQTTGRLPVVNFAAGGIATPAD
FT                   AALMMHLGAEGVFVGSGIFKSEHPERVAKAIVEAVTYKDDFERIAHLSKGLGTAMKGID
FT                   VTSMPFEERMAPRGW"
     atgatggaac ggcaacaagg atcagatcgt gtcaaacggg gaatggctga aatgcaaaag        60
     ggtggcgtca tcatggatgt cgtgaatgcg gaacaggcta aaatcgcaga agccgccgga       120
     gcggtcgctg tcatggcact tgaacgggtg ccatcggata ttcggcgtga cgggggagta       180
     gcccggatgg ccgatccgct catcacggaa gaggttctgc aggcagtatc cattcccgtg       240
     atggcgaagt gccggatcgg acatatcgtc gaagcacggg tcctcgaatc gttgggtgtt       300
     gactttattg atgaaagtga agtcctgacg ccggcagacg aggagtatca tttattgaag       360
     tcatcgttta cagtaccgtt cgtctgcgga gcacgtgatt taggagaagc ggcgcgccgg       420
     attgcagaag gagcagcgat gatccggaca aaaggggaac ccggaaccgg caatgtcgtc       480
     gaagctgtcc ggcatatgcg caagattcaa gcacaactcc accagattct tcattcacaa       540
     ccggatgaat tgatgacgcg tgctaaagag tggggcgcat cttacgaggt cttacaacag       600
     attcagacaa caggacgtct tccggtcgtg aattttgcgg ctggcggaat cgcgactcca       660
     gccgatgcgg cattgatgat gcaccttgga gccgaaggcg tatttgtcgg ttccggtatc       720
     tttaaatcgg aacatccgga acgcgtcgcg aaagcgattg tcgaagccgt gacatacaaa       780
     gacgatttcg aacggattgc ccatctgtcg aaaggactcg gaacagcgat gaaaggaatt       840
     gatgtgacgt cgatgccgtt tgaagaacgg atggcaccac gcggatggta a                891
//

If you have problems or comments...

PBIL Back to PBIL home page