(data stored in ACNUC7421 zone)

EMBL: CP001022.PE104

CP001022.PE104       Location/Qualifiers
FT   CDS_pept        129572..129835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0105"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: sgo:SGO_1976 30S
FT                   ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59592"
FT                   /db_xref="GOA:B1YGV9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV9"
FT                   /protein_id="ACB59592.1"
FT                   /translation="MERTNNRKVLTGRVVSDKMDKTIVVTVETKVKHKLYGKRVNYSKK
FT                   YKTHDENNTAKIGDVVRIQETRPLSKDKRFRLVEVVEKAVII"
     atggaacgca ctaacaaccg caaagtgtta actggacgcg tcgtatctga caaaatggat        60
     aaaacgatcg tagttacagt tgagactaaa gtaaagcaca agctctacgg caaacgcgta       120
     aactactcta agaagtacaa aacgcatgat gaaaacaaca cagctaaaat cggtgacgtt       180
     gtacgcattc aagaaacacg tccactttct aaagacaaac gtttccgtct cgtagaagtc       240
     gtcgaaaaag cagtaatcat ctaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page