(data stored in ACNUC7421 zone)

EMBL: CP001022.PE107

CP001022.PE107       Location/Qualifiers
FT   CDS_pept        130630..131169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0108"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: efa:EF0218 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59595"
FT                   /db_xref="GOA:B1YGW2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW2"
FT                   /protein_id="ACB59595.1"
FT                   /translation="MNRLKAKYQDEIVKVMMEKFNYTSVMQAPKVDKIVINMGVGDAVT
FT                   NTKALDMAVEELQLLTGQKPLITKAKKSIAGFKLREGMPIGAKVTLRGERMYEFLDKLI
FT                   NVSLPRVRDFRGVSKKSFDGRGNYTLGVKEQLIFPEIDYDRVSKVRGMDIVIVTTANTD
FT                   EESRELLTALGMPFQK"
     atgaaccgtt taaaagctaa ataccaagac gaaatcgtca aagtaatgat ggagaaattc        60
     aactatactt ctgtaatgca agcgccgaaa gtcgataaaa tcgtaatcaa catgggtgtt       120
     ggtgacgctg ttacgaacac gaaagcactt gacatggcag tcgaagagct tcagctcctc       180
     actggtcaga agccactcat cacgaaagct aagaaatcaa tcgctggttt caaacttcgt       240
     gaaggtatgc caatcggcgc gaaggtaaca cttcgtggag agcgcatgta tgagttcctc       300
     gacaagttga tcaacgtgtc acttccacgt gtacgtgact tccgtggtgt atcgaagaaa       360
     tcattcgatg gccgtggtaa ctacacgcta ggcgtgaagg aacaattgat cttcccagag       420
     atcgactacg atcgcgtatc taaagtccgt ggtatggaca tcgttatcgt tacaactgct       480
     aatacggatg aagagtcacg tgagcttctc acagcactcg gcatgccatt ccaaaaataa       540
//

If you have problems or comments...

PBIL Back to PBIL home page