(data stored in ACNUC7421 zone)

EMBL: CP001022.PE109

CP001022.PE109       Location/Qualifiers
FT   CDS_pept        131485..131883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0110"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: bha:BH0148 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59597"
FT                   /db_xref="GOA:B1YGW4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW4"
FT                   /protein_id="ACB59597.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEMPASTIKREVAEILKREGF
FT                   IRDVEYLEDSKQGTLRVFLKYGASNERVITGLKRISKPGLRVYAKADEIPKVLGGLGIA
FT                   IVSTSKGVMTDKEARQQKVGGEVIAYIW"
     atggttatga cagatccgat tgcagatatg cttacacgca ttcgtaatgc aaacatggtt        60
     cgccatgaga agttggaaat gccagcttct acaatcaaac gtgaagtcgc tgaaatcctc       120
     aaacgtgaag gtttcatccg cgatgttgaa tatctcgagg acagcaaaca aggtacgctc       180
     cgcgtattcc ttaagtacgg cgcaagcaac gaacgcgtca tcactggact caaacgtatc       240
     tcgaaaccag gtcttcgcgt ttacgcgaaa gctgatgaaa tcccgaaagt actcggtggt       300
     ctcggaatcg ctatcgtttc aacatctaaa ggtgttatga cagacaaaga agctcgccaa       360
     caaaaagtcg gcggcgaagt gatcgcatac atctggtaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page