(data stored in ACNUC7421 zone)

EMBL: CP001022.PE11

CP001022.PE11        Location/Qualifiers
FT   CDS_pept        19668..20246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0011"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG: bha:BH0023
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59499"
FT                   /db_xref="GOA:B1YGC2"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGC2"
FT                   /protein_id="ACB59499.1"
FT                   /translation="MVIGILGVQGAVREHQEMLHLLGVKTMIVKSSADLDGIDGLIFPG
FT                   GESTTIRRLIDRYGLLDVLRRQADTLPMFGTCAGMILLASELTEGPSHLGAIPMTVRRN
FT                   AFGRQIDSFETSLNVEGAGQDIEAVFIRAPFVEQVGEGVRVLAAIGIAAVVVETDLHLA
FT                   CSFHPELTSDRRLHDYFIQKIRRRTAVSV"
     atggtaatcg gtatattagg tgtccaaggc gccgtgcgcg aacatcaaga gatgcttcat        60
     ctgcttggag tcaaaacgat gatcgtcaaa tcaagcgcgg acttggacgg aatcgacggt       120
     ttaatctttc ctggcggcga atcgacgacg atccgccggc tgattgaccg ttatggttta       180
     ctggatgtct tgcgacgtca agctgacacg ttgccgatgt tcgggacatg tgccgggatg       240
     attttgctgg caagcgaatt gactgaaggt ccttcccatt taggggcgat tccgatgacg       300
     gtcagacgca atgcgttcgg acgacaaatc gacagttttg aaacctcctt gaacgttgaa       360
     ggtgccggtc aggatattga agctgttttt attcgagctc ctttcgtcga acaggtcgga       420
     gaaggagtac gtgtcctggc tgcaatcggg atagccgccg ttgtcgtcga gacggatctt       480
     catctcgcct gctccttcca tccggagctg acttcagatc ggcgtcttca tgattatttc       540
     attcaaaaaa tcagacggcg gacagctgtt tctgtttaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page