(data stored in ACNUC7421 zone)

EMBL: CP001022.PE113

CP001022.PE113       Location/Qualifiers
FT   CDS_pept        133381..133566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0114"
FT                   /product="ribosomal protein L30"
FT                   /note="PFAM: ribosomal protein L30; KEGG: gtn:GTNG_0123 50S
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59601"
FT                   /db_xref="GOA:B1YGW8"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW8"
FT                   /protein_id="ACB59601.1"
FT                   /translation="MAKLAVTLTRSMIGRPENQRVTTRTLGLRKMHQTVVVPDNAAMRG
FT                   MINHVSHLLTVKEIQE"
     atggcgaaac tcgcagttac cctcacacgc agcatgatcg gtcgtccgga gaaccaacgc        60
     gttactactc gtacgcttgg tctccgtaag atgcaccaaa ctgttgtcgt acctgacaac       120
     gctgctatgc gtgggatgat taaccacgtg tcacacttat tgacagttaa agaaattcaa       180
     gagtaa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page