(data stored in ACNUC7421 zone)

EMBL: CP001022.PE114

CP001022.PE114       Location/Qualifiers
FT   CDS_pept        133603..134043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0115"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: bha:BH0153 50S
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59602"
FT                   /db_xref="GOA:B1YGW9"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW9"
FT                   /protein_id="ACB59602.1"
FT                   /translation="MKLHELKPAAGSRSERNRVGRGMSSGNGKTSGRGHKGQKARSGGG
FT                   VRPGFEGGQNPLFRRLPKRGFNNPTRKEFAVINLDTLNRFEDGTEVTPELLIETRAVKG
FT                   MKDGVKILSNGKIEKKLTVKAHKFSEAAKQAIEAAGGTVEVI"
     atgaaactcc atgaattgaa accagctgct ggttcacgtt cagaacgcaa ccgtgtaggt        60
     cgcggtatgt cttctggtaa cggtaagact tctggccgtg gtcacaaagg tcaaaaagct       120
     cgttcaggcg gtggtgttcg tccaggtttc gaaggtggac aaaacccact tttccgtcgt       180
     ttaccaaaac gcggcttcaa caacccgact cgtaaagagt tcgcggttat caaccttgac       240
     acacttaacc gttttgaaga tggaacggaa gtaacaccag aacttcttat cgagactcgc       300
     gcagtcaaag gtatgaagga tggcgtgaag atcctttcta acggtaagat tgaaaagaaa       360
     ctgacagtaa aagctcacaa gttctccgaa gctgcgaagc aagcgatcga agctgccggc       420
     ggtacggttg aggtgatcta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page