(data stored in ACNUC7421 zone)

EMBL: CP001022.PE115

CP001022.PE115       Location/Qualifiers
FT   CDS_pept        134043..135332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0116"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: bha:BH0154 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59603"
FT                   /db_xref="GOA:B1YGX0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGX0"
FT                   /protein_id="ACB59603.1"
FT                   /translation="MFQAISNMWRVADIRRRILFTLALIIVFRIGAHIPVPMVNTEVFK
FT                   IDQNGILGFLNSFGGNALQNFSLFAMGIMPYITASIVVQLLQMDVVPKFAEWAKQGEAG
FT                   RKKLATVTRYGTIVLGLVQAFGIALGFNRIYPGLVDEQYGTWTYVMIALVLTAGTAFLM
FT                   FLGELITEKGIGNGISMIIFAGIVAGFPNAFRQIYETKLQNAGDALFVNVLYIVLLLLI
FT                   IIAVIVGVIYVQQAARKIPIQYAKRTVNRAPVGGQSTHLPIKLNAAGVIPVIFAVSFMV
FT                   TPPTVASFFASPENATKIRDIFDYTSPIGMSIYVALIIAFSYFYTFVQVNPEQMAENLQ
FT                   KQGGYIPGIRPGKQTEQYITKILYRLTFFGSLFLAVIAVTPTFFIKFAGLPNSVQIGGT
FT                   SLLIVIGVGLETMKQIESQLVKRHYKGFIR"
     atgtttcaag cgatctccaa tatgtggcgc gtagccgaca ttcgtcggcg cattctcttt        60
     accttggctc tgattatcgt gttccgtatc ggagcacata tcccggtgcc gatggtaaac       120
     actgaagtat tcaagatcga ccagaatggt attcttggtt tcttgaattc cttcggcggg       180
     aatgctttgc agaatttctc actctttgcg atgggaatca tgccgtatat cacggcctcg       240
     atcgttgtcc aactcttaca gatggacgtt gttccaaagt ttgccgaatg ggcaaaacaa       300
     ggagaggcgg gccgtaagaa gttagcaacg gtaacgcgct atggaacgat cgtactcggc       360
     ttagtccaag cgtttggaat cgcgcttgga tttaaccgta tctacccagg tcttgtcgat       420
     gagcaatacg gcacctggac gtacgttatg attgcacttg ttttgacggc gggtaccgca       480
     ttcttgatgt tcctcggtga actcatcacg gagaagggca ttggtaacgg gatatcaatg       540
     atcatcttcg ctgggattgt cgcaggcttc ccgaacgcgt tccgtcagat ctacgaaaca       600
     aagctccaaa atgcagggga tgctttgttt gtcaatgtgc tttatatcgt actgttgctt       660
     ttaatcatca ttgcggtcat cgtcggagtc atctatgtgc agcaagctgc ccgtaagatt       720
     ccgattcagt acgctaagcg tacggtgaac cgtgcaccag taggcggtca atcgacacac       780
     ttgccgatta aactgaatgc tgctggtgtt atcccagtta tcttcgctgt atcgttcatg       840
     gtgacgccac caacggttgc aagtttcttt gcaagtccgg aaaatgcgac gaagatccgt       900
     gacattttcg actatacgag tccaatcggt atgtcgatct atgtggcact gatcattgca       960
     ttttcttact tctatacatt tgttcaggtt aacccggaac aaatggcaga gaaccttcaa      1020
     aagcaaggcg gatacattcc tggtattcgt cctggtaagc aaacggaaca gtacatcacg      1080
     aagatcctgt atcgtctgac attcttcggc tcactcttcc tcgctgtcat cgcggtgacg      1140
     ccaacgttct ttattaagtt cgctggttta ccgaactcgg tgcagattgg tggaacaagc      1200
     ctgttgatcg tcatcggtgt aggtcttgag acgatgaaac agattgaaag tcaactggtt      1260
     aaacgacact acaaaggctt tatccgataa                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page