(data stored in ACNUC7421 zone)

EMBL: CP001022.PE118

CP001022.PE118       Location/Qualifiers
FT   CDS_pept        136955..137173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0119"
FT                   /product="translation initiation factor IF-1"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1 IF1 family protein; KEGG:
FT                   bha:BH0158 translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59606"
FT                   /db_xref="GOA:B1YGX3"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGX3"
FT                   /protein_id="ACB59606.1"
FT                   /translation="MAKQDVIEVEGTVIEPLPNAMFKVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRFK"
     atggcgaaac aagatgtaat cgaagtggaa ggtacggtta tcgaaccgct tccaaacgcg        60
     atgtttaagg tggagttaga aaacggccac acggtcctcg cgcacgtctc aggaaaaatt       120
     cggatgcact tcattcggat cctaccagga gataaagtaa cggttgagtt gtcaccatac       180
     gacttgactc gcggacggat cacataccgt ttcaaataa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page