(data stored in ACNUC7421 zone)

EMBL: CP001022.PE121

CP001022.PE121       Location/Qualifiers
FT   CDS_pept        137723..138118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0122"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: bpu:BPUM_0129
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59609"
FT                   /db_xref="GOA:B1YGX6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGX6"
FT                   /protein_id="ACB59609.1"
FT                   /translation="MAKRKQNVRSKRKVKKNIESGIVHIRSTFNNTIVTITDMQGNAIS
FT                   WATAGNMGFKGSRKSTPFAAQLASETAAKTAMDNGMRTVEVNVKGPGAGREAAIRALQA
FT                   IGLEVTAIRDVTPVPHNGCRPPKRRRV"
     atggcaaaac gtaaacagaa tgttcgtagt aaacgtaaag tcaaaaagaa tattgaatct        60
     ggtatcgtgc atatccgttc aacattcaac aacacaatcg ttacgatcac tgacatgcaa       120
     gggaatgcaa tctcttgggc aactgcaggt aacatgggct tcaaaggctc acgtaaatct       180
     actccatttg ctgcgcaact cgcttcagaa actgctgcga aaacagcaat ggacaacggt       240
     atgcgtactg tagaagttaa cgttaaaggt cctggtgcag gtcgtgaagc tgcaatccgt       300
     gcgcttcaag caatcggtct tgaagtaaca gcgatccgtg acgtaactcc agttccacac       360
     aacggttgcc gccctccaaa acgtcgtcgc gtgtaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page