(data stored in ACNUC7421 zone)

EMBL: CP001022.PE125

CP001022.PE125       Location/Qualifiers
FT   CDS_pept        140520..141377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0126"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bpu:BPUM_0133 cobalt (Co2+) ABC superfamily ATP
FT                   binding cassette transporter, ABC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59613"
FT                   /db_xref="GOA:B1YH81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH81"
FT                   /protein_id="ACB59613.1"
FT                   /translation="MPILIQELNYTYQLNSPFERVALRDVNLEIPSGALVAFVGHTGSG
FT                   KSTLVQHINGLLKPTAGKVQVDDIIIEPKRKQDLKALRKRVGLVFQYPEYQLFEETVLK
FT                   DVMFGPMNFGHAPAEAERLAKDALRTVGLDEVFWSRSPFDLSGGQMRRVAIAGVLASQP
FT                   DVLIVDEPTAGLDPQGRKQMLSLFAELHAQSGMTLLLITHDMDQVLEYTNRVVVMEEGQ
FT                   VAYDGEPMGLFRQETLLRQFHLDLPHVLAFAWQMADQLNQPRPSLQTEAELIDWILHVR
FT                   EDKR"
     atgccaatct taatccagga attaaactat acgtaccaac tcaatagtcc gtttgaacga        60
     gtcgcgctgc gtgatgtgaa tcttgagatt ccgtcagggg cgcttgttgc gtttgtaggg       120
     cataccggtt ccgggaagtc gacactcgtc caacacatca acggcttgtt gaaaccaaca       180
     gctgggaagg tacaggtcga tgacatcatc atcgaaccga aacgaaaaca agatttaaaa       240
     gcactccgga aacgggtggg tcttgtcttt cagtatccgg aatatcaatt gttcgaagaa       300
     accgtcttga aagatgtcat gtttggtccg atgaacttcg gtcacgcacc ggcagaggca       360
     gaacggttag cgaaagatgc cttacgtacc gttggactcg atgaagtctt ttggtcacgt       420
     tctccgtttg acctgtctgg tgggcaaatg aggcgtgttg cgattgcggg cgtactcgct       480
     agtcaaccag acgtgttgat cgtcgatgaa ccgacagcag gactcgatcc gcaaggacgg       540
     aagcagatgc tttctctctt tgccgagttg catgcacagt caggaatgac attgctgttg       600
     attacgcatg acatggacca ggtgctggaa tatacgaacc gcgtcgtcgt catggaagag       660
     ggccaggttg cgtatgacgg agaaccaatg ggtctattcc gtcaagaaac gttactgcgt       720
     caattccatc tcgatttacc ccacgttctg gcctttgcct ggcagatggc cgatcaattg       780
     aaccaaccgc gtccatcgct tcagacggaa gcggaattga ttgactggat tttgcatgta       840
     cgggaggata aacgatga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page