(data stored in ACNUC7421 zone)

EMBL: CP001022.PE128

CP001022.PE128       Location/Qualifiers
FT   CDS_pept        143070..143507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0129"
FT                   /product="ribosomal protein L13"
FT                   /note="PFAM: ribosomal protein L13; KEGG: bha:BH0168 50S
FT                   ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59616"
FT                   /db_xref="GOA:B1YH84"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YH84"
FT                   /protein_id="ACB59616.1"
FT                   /translation="MRTTFMAKATDVERKWLLIDAEGKTLGRLSSEVASLLRGKHKPTF
FT                   TPHVDCGDHVILINVEKIVLTGNKLDKKVYYRHSGHPGGLKQTVARDLLANKPERMLEL
FT                   AIKGMLPKGSLGRQMFNKLHVYAGDTHKQEAQQPEVYELRG"
     atgcgcacaa ctttcatggc gaaagctact gatgtagaac gcaaatggct ccttatcgac        60
     gcagaaggca aaacactcgg tcgtctttcg agcgaagttg cttcacttct ccgcggtaag       120
     cacaaaccta cgttcacacc acacgttgac tgtggggatc acgttatcct catcaacgtt       180
     gagaaaatcg ttttaactgg taacaaactc gacaaaaagg tctactaccg tcactctggt       240
     catccaggcg gcttgaagca gactgtcgca cgcgacttac tcgctaacaa acctgagcgt       300
     atgcttgaac tcgcgatcaa agggatgctt ccaaaaggta gcctcggtcg tcaaatgttc       360
     aacaaactcc acgtttacgc tggagatact cataagcaag aagcacaaca accagaagtt       420
     tacgaacttc gcggttaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page