(data stored in ACNUC7421 zone)

EMBL: CP001022.PE135

CP001022.PE135       Location/Qualifiers
FT   CDS_pept        154091..154654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0136"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; RNA polymerase sigma-W factor; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: bld:BLi00199 RNA polymerase
FT                   sigma factor SigW"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59623"
FT                   /db_xref="GOA:B1YH91"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH91"
FT                   /protein_id="ACB59623.1"
FT                   /translation="MEETTLRLIERVKQGDRDAFAALVDLYKEGAFLVAFRVLRDRMEA
FT                   EDATQEAFIRVFTKIESYNAQWKFRTWLYRIVTNVSIDRLRKKRPDYSLDAEMSGTEGL
FT                   TLYSQLESKDQLPEDQVIDSEQRQDVGEAIAGLPEKYRIPLVLKYVEDLSLKEISEMID
FT                   LPVATVKTRIHRGREALKKHFGKR"
     gtggaagaaa caacactacg cttgattgag cgggtgaagc agggagaccg tgatgcattc        60
     gcggcacttg ttgatctata taaagaagga gcctttttgg tcgccttccg tgttttacgg       120
     gatcgaatgg aagccgaaga tgccacacaa gaagccttta tccgcgtatt caccaaaatt       180
     gaatcgtata atgcccagtg gaagttccgg acttggttgt atcggatcgt gacgaatgtt       240
     tcgattgacc gactccgcaa aaaacgtccg gattattccc ttgatgccga gatgtcgggg       300
     actgaaggac tgacgttgta ttcccagctt gaaagcaagg accagttgcc ggaagatcaa       360
     gtcattgatt cggaacaacg acaagatgta ggggaagcca tcgccggtct gccggaaaaa       420
     taccggattc cgcttgtctt gaaatatgtt gaagatcttt cgctcaagga aatcagtgag       480
     atgatcgatt tacccgtcgc tacagttaaa acgagaattc atcggggacg cgaagcgctg       540
     aaaaagcatt tcggcaaacg atga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page