(data stored in ACNUC7421 zone)

EMBL: CP001022.PE137

CP001022.PE137       Location/Qualifiers
FT   CDS_pept        155371..156231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0138"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   bha:BH0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59625"
FT                   /db_xref="GOA:B1YH93"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH93"
FT                   /protein_id="ACB59625.1"
FT                   /translation="MNYFNWQPLQFQLLKLGENVHWYDYINDVIDIAVVTFVIYRLMII
FT                   VKGTKAVQLIKGISVILISWFLSGFFGLKTLQFLLNQIITYGLLGIIIIFQPELRRGLE
FT                   HLGRTSKFFSRSAISDEDEQVRIVDALVTSAQYMSKRRIGALVTIERETGLSEYVETGI
FT                   PLGSQITSQLLINLFIPNTPLHDGAVIVQQGKLAAAACYLPLSESAHISKDLGTRHRAA
FT                   IGVSEVTDSVTLVVSEETGGVSLAINGRLYRELDEESLRTKLLETIVKAEPTNTSFLNW
FT                   MGAKK"
     gtgaattact tcaactggca accacttcaa tttcaattgt tgaaactggg agaaaacgta        60
     cattggtacg attatattaa cgatgtgatt gatatcgcgg tcgtaacatt cgtcatttac       120
     cgtctgatga tcattgtcaa aggtacaaaa gcagtccaat tgatcaaagg gatttcggtc       180
     attttgatca gctggttctt aagcggattc ttcggactga agacgttaca atttctgctg       240
     aaccaaatca ttacgtacgg tctgctcggg attatcatca ttttccagcc ggaattacga       300
     cggggactgg aacacctagg acggacaagt aaatttttct cacggagcgc gatcagtgac       360
     gaggacgaac aagtccggat tgtcgacgcg ttggtcacgt ctgcacagta catgtccaaa       420
     cgccggatcg gggcactggt cacgattgag cgggaaacgg gacttagcga atatgtcgaa       480
     accggcattc cgcttggttc tcaaatcacg agtcagttat tgatcaacct gtttattccg       540
     aacacgcccc tccatgatgg ggccgtcatc gtccaacaag gtaaacttgc ggcagccgct       600
     tgttacttac cgctttctga gagtgcacat atctcaaaag atcttggaac acgtcaccgg       660
     gcagccatcg gtgtcagcga agtgacagat agcgtgacgt tggtcgtatc agaagaaacc       720
     ggtggtgttt cccttgccat caatggtcgt ctgtaccggg agctggatga agaatcgctc       780
     cggacgaagt tacttgaaac gattgtcaaa gctgaaccga cgaatacttc cttcttgaac       840
     tggatggggg cgaaaaaata a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page