(data stored in ACNUC7421 zone)

EMBL: CP001022.PE139

CP001022.PE139       Location/Qualifiers
FT   CDS_pept        157547..158902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0140"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="KEGG: gtn:GTNG_0151 phosphoglucosamine mutase;
FT                   TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59627"
FT                   /db_xref="GOA:B1YH95"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YH95"
FT                   /protein_id="ACB59627.1"
FT                   /translation="MGKYFGTDGVRGVANVELTPELAYRLGRTGGYVLTKHESTRPKVL
FT                   IGRDTRVSGQMLENALIAGLLSIGAEVMRLGVISTPGVAYLTKTMDATAGVMISASHNP
FT                   VEDNGIKFFGSDGFKLDDATELEIEGLLDEAEDTLPRPSGKELGFVHDYYEGAQKYLHM
FT                   LRQTSDEDFSGIHVAIDGAHGATSSLAPRLFGDLEAEVSTIGTTPNGLNINEGVGSTHP
FT                   EHLADFVLEKGADVGLSFDGDGDRLIAIDENGKIVDGDKIMFICGKYLNEIGRLKDNTI
FT                   VATVMSNLGFHKTVAEHGMTALQTAVGDRYVVEEMRKNNYTLGGEQSGHIIFMDYSTTG
FT                   DGMLSGVQLLQIMKATGKKLSELAAEMPVFPQRLVNIRVSDKNGAMNGPAVQAIIAEVE
FT                   AEMAGNGRILVRASGTEPLVRVMAEAPTQEACDMYVERIANVVRENYALQEN"
     atgggtaagt attttggaac tgacggcgtc cgcggcgtcg caaacgtaga attgacacct        60
     gaactggcat atcgtctcgg tcggacaggc gggtatgtct taacgaaaca cgaaagcaca       120
     cgtccgaaag tcttgatcgg ccgcgataca cgtgtctctg gacaaatgct tgaaaatgcc       180
     ttgattgccg gactcctgtc aatcggagcg gaagtcatgc gtcttggtgt catctcgaca       240
     ccgggtgtcg catacttgac gaagacgatg gatgcgacag caggcgtcat gatttcggcg       300
     tcacataatc cggtcgaaga caacggaatc aaattcttcg gatcagacgg cttcaagctc       360
     gatgatgcaa cagaacttga aatcgaaggt ttgcttgacg aagccgaaga tacgttgcca       420
     cgtccgtccg gtaaagagct tggattcgtc cacgattact atgaaggcgc acaaaagtac       480
     cttcacatgt tacgtcagac atcagatgaa gatttctctg gtatccatgt cgccatcgac       540
     ggcgcgcacg gtgcaacatc aagcctcgca ccacgtctgt tcggtgatct cgaagcggaa       600
     gtctcgacaa tcggaacgac accaaacggt ttgaacatca acgaaggtgt cggctcgacg       660
     caccctgaac atttagctga cttcgtcctt gaaaaaggcg cagacgtcgg tctgtcattt       720
     gacggcgacg gcgaccgttt gattgcaatc gatgagaacg gtaaaatcgt cgacggcgat       780
     aaaatcatgt tcatctgcgg aaaatacctc aatgaaatcg gccgcttaaa agacaatacg       840
     atcgttgcaa cagtcatgag taacctcggc ttccacaaga cggtcgcaga acacggcatg       900
     acagcattac agacagcagt cggtgaccgc tatgtcgttg aagaaatgcg taaaaacaac       960
     tatacactcg gcggggaaca gtcgggtcat atcatcttca tggattactc cacaacagga      1020
     gacggaatgc tgtcaggcgt tcaacttctg caaatcatga aggcgacagg caaaaagttg      1080
     tcggaacttg cagccgaaat gccggtcttc ccacaacgtc tcgtcaatat ccgcgtgtcg      1140
     gataaaaacg gcgcgatgaa cggtccggcc gttcaagcca tcattgccga agtggaagcg      1200
     gaaatggccg gcaacggtcg gatcctcgtc cgcgcgtcag ggacagaacc acttgtccgt      1260
     gtcatggcag aagcaccgac gcaagaagca tgtgacatgt atgtcgagcg gattgcaaac      1320
     gtcgtccgtg aaaactacgc gttacaagaa aattga                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page