(data stored in ACNUC7421 zone)

EMBL: CP001022.PE14

CP001022.PE14        Location/Qualifiers
FT   CDS_pept        complement(24238..24915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0015"
FT                   /product="deoxynucleoside kinase"
FT                   /note="PFAM: deoxynucleoside kinase; KEGG: oih:OB0015
FT                   deoxypurine kinase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59502"
FT                   /db_xref="GOA:B1YGC5"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGC5"
FT                   /protein_id="ACB59502.1"
FT                   /translation="MNSKLREKYNIPADAVITIGGMVGIGKSTITNGLADSLGFRTSLE
FT                   KVDTNPYLDKFYHDFERWSFHLQIYFLAERFKEQKKIFQYGGGFIQDRSIYEDTGIFAK
FT                   MHFEKGTMSPTDYETYSSLFDAMVMTPFFPHPDLLIYLEGSFEQVLERIRLRGREMEQQ
FT                   TPIEYWEEMYERYTNWINNFTICPVLRLSIDEYDLLNEPESIERILSKIDKQLEVARTA
FT                   KIR"
     atgaactcga aattacgtga aaagtataac atcccggcag atgccgtcat tacgattggt        60
     ggaatggtcg gtatcggtaa atcgacgatt acaaacggtc tagcagactc tcttggtttc       120
     cggacatctc ttgaaaaagt cgatacaaac ccttacctgg acaaatttta tcatgatttc       180
     gagcgctgga gctttcactt acaaatttac ttccttgctg aacgttttaa ggaacaaaag       240
     aaaatcttcc aatacggcgg cggtttcatt caagaccgtt cgatttacga agatacaggt       300
     atcttcgcga agatgcattt cgaaaaagga acgatgtcac caacggatta cgaaacctac       360
     tcgagtttgt ttgacgccat ggtcatgaca ccattcttcc cgcatccgga tctcctgatt       420
     tatctcgaag gctcgtttga acaagttctt gagcggattc gcttacgcgg acgcgaaatg       480
     gaacaacaaa cgccaatcga gtattgggaa gagatgtacg aacgttacac gaactggatc       540
     aataacttca cgatttgtcc ggttctccgt ttatcaatcg atgaatacga tttattaaac       600
     gagccggaat cgatcgaacg gattttatca aaaatcgata aacaacttga agttgcccgc       660
     actgctaaaa tccgctaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page