(data stored in ACNUC7421 zone)

EMBL: CP001022.PE144

CP001022.PE144       Location/Qualifiers
FT   CDS_pept        complement(164084..164266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59632"
FT                   /db_xref="GOA:B1YHA0"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA0"
FT                   /protein_id="ACB59632.1"
FT                   /translation="MELVPLFFVTFIIVLAVNLFLDKMIMNREMTRPVFLKNLLICFLI
FT                   SLVLLNVFYLQSLMS"
     atggaattag tcccgctctt ttttgtaacg tttatcatcg tcttggctgt aaatctgttt        60
     ctcgacaaga tgatcatgaa ccgcgaaatg acacgacctg tttttttgaa aaatctgctg       120
     atttgcttct tgatttcgct ggttctgtta aacgtctttt acttacaatc tttgatgagc       180
     tga                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page