(data stored in ACNUC7421 zone)

EMBL: CP001022.PE146

CP001022.PE146       Location/Qualifiers
FT   CDS_pept        165261..167582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0147"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: bha:BH0336 hypothetical protein; TIGRFAM:
FT                   CRISPR-associated helicase Cas3; CRISPR-associated HD
FT                   domain protein; PFAM: helicase domain protein;
FT                   metal-dependent phosphohydrolase HD sub domain; DEAD/DEAH
FT                   box helicase domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59634"
FT                   /db_xref="GOA:B1YHA2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA2"
FT                   /protein_id="ACB59634.1"
FT                   /translation="MRYIAHVHSTDGKIQEVKTHLLEARGLAENWGKDIGLMHVCGVAG
FT                   LLHDIGKLSDEFQTYIRKATSGEHVRRGEVDHATAGGRLLFEQLKGNRGQLLAEMVANA
FT                   ILSHHGNLQDYYLEEESPFLQRVERKELPSYKMCRERFFQVVIDEQEFNRYVERAVDEL
FT                   YSWILRDGGSTARVSLATKYIFSILLDADRTNTREFEQGITTMTTQVDFEELKRRLETH
FT                   LSTFSQQTEITPINRLRQEMSDACRVFANQPSGVYTLSIPTGGGKTLASLRYALHHATT
FT                   YQKKRIIYVVPFTTIIEQNARVARDVLGTDMILEHHSNVVEIEDASDDVMDIQAKLHLA
FT                   KDNWDAPIIFTTMVQYLNTFYAKGNRNTRRLHHLSEAIIIFDEVQKVPLKCISLFNESV
FT                   KFLKDSLESSVVLCTATQPALEFVKYQLHQDGEMIDALPQVMEAFRRTDLEVVEGEMDT
FT                   ARLAEVVTRQVEEKNSVLVILNTKSVVKKLYETLRQQHPDEEVIHLSTAMCAAHRMDIL
FT                   RTINQRLEQGERIICISTQLIEAGVDVSFACVIRSLAGLDSIAQAAGRCNRHGEVARQT
FT                   VYLVDHIEENLKHLPEIARGKEIVRAILIDFLRDEQSYEGNLLGTVAMTRYFQELYDAS
FT                   EVELDFPIRGTTLTLAPMLFKPRKVPELILSSRHRTVANHFKVIEDMTETVLVPYGEEG
FT                   KRLIASLNGQADWEDLRKWLKQAQQYSINLHAHERKKLEATQGLNVILDGTVLVLSERA
FT                   YDDHYGLNLEQDSLLEDLMM"
     atgcgctaca tcgcacatgt acattcaacg gacgggaaga ttcaagaagt taaaacccat        60
     ctacttgaag cacgtggact tgcagaaaat tgggggaaag atattggatt gatgcatgtc       120
     tgcggggtgg cagggctttt acacgatata ggaaagctga gtgatgaatt tcagacatat       180
     attcgaaagg cgacatcagg tgagcacgtc cgacgtgggg aagtcgatca tgcaactgca       240
     ggtggaagac tgttattcga acaactcaaa ggaaatcgtg gacaactcct tgcggaaatg       300
     gtcgcaaatg cgattctttc acaccacggt aaccttcagg actactatct agaagaggaa       360
     tcaccctttt tacaacgcgt cgaacgaaaa gaacttcctt cctataaaat gtgccgtgag       420
     cgatttttcc aggtggtcat cgatgagcaa gaattcaatc gctatgtcga acgggccgtt       480
     gacgaattat atagctggat tttacgagat ggcggttcga ccgcgcgagt gtcactcgct       540
     acgaaatata tatttagtat cttactagat gccgatcgga cgaacacaag agaatttgaa       600
     caaggaataa caaccatgac gacacaagtt gactttgaag aactgaagag acgactcgaa       660
     acacacttgt ctacattttc acagcagaca gaaattacgc caattaatcg tttgcgtcaa       720
     gaaatgtctg acgcatgtcg agtatttgcc aatcaaccaa gtggagtcta tacactgtca       780
     atcccgacag gtggagggaa aacgcttgct agtttacgtt atgcacttca tcatgcaaca       840
     acatatcaaa agaaacgtat catttatgtt gtaccgttta cgacgatcat cgaacagaat       900
     gcacgtgttg caagagacgt actaggaaca gatatgattt tagagcacca ttcgaacgtc       960
     gtcgagatag aagatgcctc agatgatgta atggacattc aagcgaaatt gcatctagcg      1020
     aaggacaatt gggatgcacc gattatcttc acgacgatgg ttcaatatct caatacgttt      1080
     tacgcgaaag gaaaccgtaa tacgaggcgt ttacatcatt taagtgaagc tatcattatt      1140
     tttgacgagg ttcagaaagt tccactcaaa tgtatttcac ttttcaacga gtcggtgaag      1200
     tttttaaagg attcgttgga gtcgagtgtg gtcttgtgta cagcaacaca acctgcactt      1260
     gaatttgtaa agtaccaact tcaccaagat ggagagatga ttgatgcgtt accgcaagtg      1320
     atggaagctt ttagacgaac ggacttagaa gttgttgaag gagagatgga tacagcacgt      1380
     cttgctgagg ttgtgacgag acaagtagag gaaaagaata gtgttttagt aattcttaat      1440
     acaaaaagtg tcgtcaaaaa actttatgaa acattacgac agcaacatcc cgatgaagaa      1500
     gtcattcatc tcagtacagc gatgtgtgca gcacatcgga tggatatcct tcgaacaatc      1560
     aatcagcgac tagaacaagg agaacgtatc atatgtatta gtacccagtt aatcgaggca      1620
     ggagtcgatg ttagctttgc ttgtgtcatt cgttcactag cgggactcga ttcaattgca      1680
     caagcagcag gacggtgtaa tcggcatggt gaagttgcac gacaaacagt gtatctcgtc      1740
     gatcatatag aggaaaatct aaaacatctt ccggaaattg cccgtggtaa ggaaattgtt      1800
     cgtgcgattc ttattgattt tctccgtgat gaacagtcgt acgagggaaa tttgttggga      1860
     acagtagcca tgacccgata ttttcaagaa ctttatgatg cttctgaagt agaactcgat      1920
     ttcccaattc ggggaacgac attgacactc gctccgatgt tgtttaaacc aagaaaagtg      1980
     cctgaactga ttttgtcgag ccgtcaccga acggtcgcga atcattttaa ggttattgag      2040
     gatatgaccg agacggtact cgttccttat ggtgaagaag gaaaacgctt gattgcttct      2100
     ctcaatggac aagcagattg ggaagacttg cgtaaatggt taaaacaagc gcagcaatac      2160
     agtatcaact tgcatgctca cgaacgaaaa aaattagaag caacgcaggg actgaatgtc      2220
     attttggatg gcacagttct tgtcttgagt gaacgtgcgt acgatgatca ttacggactg      2280
     aacttagagc aggactcgtt actagaagac cttatgatgt aa                         2322
//

If you have problems or comments...

PBIL Back to PBIL home page