(data stored in ACNUC7421 zone)

EMBL: CP001022.PE148

CP001022.PE148       Location/Qualifiers
FT   CDS_pept        168311..170176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0149"
FT                   /product="CRISPR-associated protein, Csd1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csd1 family;
FT                   PFAM: CRISPR-associated protein CT1133; KEGG: bha:BH0338
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59636"
FT                   /db_xref="InterPro:IPR010144"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA4"
FT                   /protein_id="ACB59636.1"
FT                   /translation="MSVWKQLYDTYEMNLKHVGQFESRWEGQDFTLLPLSHTTQTAHVT
FT                   VTVTLDGDFHSATVIEKGHGNTLIPCTEDSANRAGSVVAPYPLHDKLAYVAGDFLKYGG
FT                   VYKGENAHHAYLSQLKAWVETAPYDPLESIYCYVQKGQLIEDLIQEGIFSATGSGELRW
FT                   TWKEAGDKPPIYGLVTGGLEGTFVRFQVRSTEGVQRQPWRDKAFFDSFITFYGTRPGKE
FT                   GLCFVTGKQERLSSKHTNKIRNSGDKAKLISANDSSGFTFRGRFDKPDEAASISYQASQ
FT                   KAHNALKWLIQRQGRSIDQRVFLIWGNQQPSLPNPLENTLSLAQLFGEKEELISHTVQE
FT                   GALAFSDALLGFKRRLPKQEVNILTLDAATTGRMAILYYRTFDQETYFKRLEQWHTKYP
FT                   WEYIYQDADKKRQVYIGAPSLKDIALMTYGTRGNEKLIKATVERLLSCVIDERRVPMDI
FT                   IRCLTQRASNPVGMDHWEWEKTLSIACGMVNKKEEMTVSLDQEINDRDYLFGRLLALAD
FT                   YLERRALGQDNRATNAIRYMNAFSQNPARTWMTIQSALQPYQAKLGGKVLFINRQIDEI
FT                   GSRLTIEQFTNKPLSGKYLLGFYSQRHELYQKREETFDKEERGEA"
     atgagtgttt ggaaacagtt atacgatacg tacgaaatga acttgaagca tgtcggtcag        60
     tttgaaagcc gttgggaagg acaggacttc acactgcttc cactttcgca tacgacgcaa       120
     actgcacatg tgacggtaac agtaacgctg gacggagatt ttcattcggc gacagtcatc       180
     gaaaaagggc atggaaatac gttgattccg tgtacggaag actctgcgaa tcgtgcaggg       240
     agtgtcgttg ccccgtatcc gttgcacgac aaattggcat atgtcgcagg cgatttcttg       300
     aagtatggtg gtgtttataa aggtgagaac gcacaccatg cttatcttag ccaactcaaa       360
     gcctgggttg aaacagctcc atatgatcca ctcgagagca tttattgtta tgttcagaaa       420
     ggtcagttga tcgaggattt gattcaagag ggtatttttt ctgctactgg gagtggtgaa       480
     ctccgctgga catggaagga ggcaggggac aagccgccga tttatggact tgtcactggt       540
     ggactcgaag ggacatttgt ccgttttcag gtacgttcaa cggaaggcgt gcagcgacaa       600
     ccttggcggg ataaggcatt ctttgattca ttcattacgt tttatggaac acgtccagga       660
     aaggagggcc tttgttttgt aactggtaaa caagaacggt tatcttcgaa acacacaaat       720
     aagattcgaa attcagggga taaagcaaag ctcatttctg cgaacgatag ctctggattt       780
     acatttcgag ggcggtttga taaaccggac gaagctgcaa gtattagcta tcaagcctcg       840
     caaaaagcac ataacgcatt aaaatggctc atccagcgac aaggtcgtag tatcgaccag       900
     cgtgtgttct tgatttgggg aaatcaacaa ccgagtctac cgaatccact cgagaatacg       960
     ttatcacttg cacaactctt tggcgaaaaa gaggaactca tctcacatac ggttcaagaa      1020
     ggagctcttg ccttttcgga tgcattactc ggatttaagc ggcggttacc gaaacaagag      1080
     gtgaatattt tgacactcga tgcagcgacg acaggacgaa tggcaattct gtattaccgg      1140
     acgtttgatc aagagacgta cttcaaacga ttagaacaat ggcacacgaa gtatccgtgg      1200
     gaatatatct accaagatgc agataaaaag cgtcaagtgt acatcggtgc tccttcttta      1260
     aaagatatcg cactgatgac ctatggtacg cgaggaaatg aaaaattaat caaagcgacc      1320
     gtcgagcgtt tgttatcttg tgtcatcgat gaacggcgtg tcccgatgga tattatccgt      1380
     tgtctcacac aacgcgcatc gaatcctgtg gggatggatc actgggagtg ggagaagacg      1440
     cttagtattg cttgcggcat ggtcaataaa aaggaggaga tgacagtgtc attggatcaa      1500
     gaaataaacg atcgagatta tttatttggt agattgcttg cgcttgctga ctatttggaa      1560
     cgtcgagcgt taggacagga caaccgggcg acaaatgcga ttcgttatat gaacgccttt      1620
     tctcaaaatc cagcaagaac gtggatgact attcaaagcg ctctgcaacc ctaccaagcg      1680
     aagctcggcg gaaaagtgtt gttcattaac cgtcaaatcg atgagatagg ttcacgcctg      1740
     acaatcgaac aatttactaa caagccgcta tctggtaagt acctgctagg tttttatagc      1800
     caacggcacg aactgtatca aaaacgtgaa gagacatttg acaaagagga gcgtggcgaa      1860
     gcatga                                                                 1866
//

If you have problems or comments...

PBIL Back to PBIL home page