(data stored in ACNUC7421 zone)

EMBL: CP001022.PE151

CP001022.PE151       Location/Qualifiers
FT   CDS_pept        171679..172710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0152"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; KEGG: bha:BH0341
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59639"
FT                   /db_xref="GOA:B1YHA7"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019856"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA7"
FT                   /protein_id="ACB59639.1"
FT                   /translation="MKKLLNTLFINQSDSYLALDGGNVLVKADGQVLGRVPLHNLEGIV
FT                   AFGYTGASPALMGHCAENGIALTFMTKNGRFLARVIGESRGNVVLRKTQYRRSDDEVAS
FT                   ARLAKNFILGKLYNQKWMLERMTRDYPLRLDVERFKTTSQDMTETMREIQVCENLERLR
FT                   GLEGTIAVRYNRLFDSMILQQKEDFHFKGRTRRPPLDRVNAMLSFAYSLLARDVSAALE
FT                   AVGLDAYVGFLHRERPGRASLALDVMEELRGIYADRFVLSLINKKVIQGKDFLQKENGA
FT                   VIMTEEGRKTFLTAWQKKKQETIQHPYLKEKMMWGLVPYEQALLLARHLRDDLEAYPPF
FT                   LYK"
     gtgaaaaagc ttctgaacac attgtttatc aatcagtctg actcttacct agcacttgat        60
     ggaggaaatg tcctcgttaa agcggacggc caagttctgg gtagagttcc tttgcataat       120
     ctagaaggaa tcgtcgcatt tggttataca ggagcaagtc ctgctttgat ggggcattgt       180
     gcagaaaacg gcatagcgct gacgtttatg acgaaaaatg gtcggttttt agcgcgtgtc       240
     attggagaaa gtagaggaaa cgttgttttg cgaaaaacac aataccgacg ctcggatgat       300
     gaagttgcat cggcacggct cgcgaaaaac ttcatcctag ggaaactcta taatcaaaag       360
     tggatgctag aacgaatgac gcgtgattat ccgttgcgtc ttgatgtcga acggttcaaa       420
     acaacttctc aagatatgac ggaaacgatg cgtgaaatcc aagtctgcga aaatctcgaa       480
     cgtttaaggg gattagaagg aacgattgct gttcggtaca accgattgtt tgattcgatg       540
     atcctacaac agaaagaaga ttttcacttc aaaggaagaa cccgtcgtcc accgctagat       600
     cgagttaacg cgatgttatc attcgcgtat agcttactcg cgcgtgatgt aagtgcagca       660
     ctagaagcag tcggacttga cgcgtatgtt gggtttttac atcgtgaacg tccaggacgg       720
     gcatcacttg ctctcgatgt gatggaagaa ctgcgtggta tctatgcgga tcgttttgtt       780
     ctctctttga tcaataaaaa agtcattcaa ggaaaagact ttttacaaaa agagaacgga       840
     gcagttatca tgacagagga gggaagaaaa acctttttaa cagcatggca aaaaaagaaa       900
     caagaaacga ttcagcatcc ttacttaaag gaaaaaatga tgtggggttt ggttccatat       960
     gaacaagcgt tacttctcgc ccgacatctc agagacgatt tggaagcata tccaccgttc      1020
     ctctataaat ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page