(data stored in ACNUC7421 zone)

EMBL: CP001022.PE156

CP001022.PE156       Location/Qualifiers
FT   CDS_pept        176861..177712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0157"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   bth:BT_0778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59644"
FT                   /db_xref="GOA:B1YHB2"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB2"
FT                   /protein_id="ACB59644.1"
FT                   /translation="MDIKKYRVTPGESIHLSDYPTSDENRIAEDELLDQHIPKSVEELK
FT                   ELHWRLHAEEKNGVLVILQAIDAGGKDEAISYIFSNLNAQGLRTLSVKKPSDTEKKHDY
FT                   LWRIHEGLPEKGEVGILNRSYYEEVIAPRIHDLLEEEEVPDDQDVWKMRYRQINDFERY
FT                   LVENGFRVVKFLFNVSKDEQKKRLLERIKDPKKNFEFSFSDVEEREHWDEYQDIFAELV
FT                   SHTSTEHAPWHVLPADDEWFTRYIVTEVMNDVLREIDPQYPKLTDEDQEKLDEAIKKLE
FT                   NE"
     atggacataa aaaaataccg tgtaacaccg ggcgaatcga ttcatttgtc ggattatccg        60
     acgtcagatg aaaaccgtat tgcagaggat gagttactgg atcagcacat cccgaaaagt       120
     gtcgaggaac taaaggaact ccactggcgt ctgcatgccg aagagaaaaa cggcgttctt       180
     gtcatcctgc aagcgattga tgccggcgga aaagatgaag ccatcagcta tatcttctcg       240
     aatctcaacg cccaaggcct gcggacactg tccgtcaaaa aaccgtcaga tacggagaaa       300
     aagcatgatt atctctggcg gattcacgaa ggcttgccgg aaaaaggcga agtcggcatt       360
     ttgaaccggt cgtattacga agaagttatc gcaccacgga ttcatgacct gctcgaagaa       420
     gaggaagtac cggacgatca agacgtttgg aagatgcgtt accgccaaat caatgacttt       480
     gaacgttatc tcgtcgagaa cggtttccgc gtcgtcaagt ttctgtttaa cgtctcaaaa       540
     gacgagcaga aaaaacgatt gcttgaacgg atcaaagatc cgaagaaaaa ctttgagttt       600
     tcgttcagtg acgtcgaaga gcgggagcac tgggacgaat accaggacat ctttgccgag       660
     cttgtctcgc acacgtcaac ggaacacgcg ccgtggcatg tcctgccggc cgatgacgaa       720
     tggttcaccc gttacatcgt gacagaggtc atgaatgacg tcctgcgtga aatcgatccg       780
     cagtatccga agctgacgga cgaggatcag gaaaaactcg atgaagcgat taaaaagctg       840
     gaaaacgaat aa                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page