(data stored in ACNUC7421 zone)

EMBL: CP001022.PE157

CP001022.PE157       Location/Qualifiers
FT   CDS_pept        177862..178200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0158"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="TIGRFAM: alkylphosphonate utilization operon protein
FT                   PhnA; PFAM: PhnA protein; KEGG: bcz:pE33L466_0444
FT                   alkylphosphonate uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59645"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB3"
FT                   /protein_id="ACB59645.1"
FT                   /translation="MNEYPNCPKCGSAYTYEDGNVFVCPECAHEWTAADAEVAEEATVI
FT                   RDANGNVLNDGDTITVIKDLKVKGTSLVVKQGTRVKGIRLVDGDHDIDCKIDGLGAMKL
FT                   KSEFVKKI"
     atgaatgaat acccgaattg tccgaaatgt ggctcagcgt atacatatga agacgggaat        60
     gtattcgtgt gtccggaatg tgcccatgaa tggacggcag ccgatgcaga agtggcggaa       120
     gaagccactg tcatccggga tgcgaacggg aacgtattaa acgatggtga tacaattacg       180
     gtcattaaag acttaaaagt gaagggcacg tcgcttgtcg tcaaacaagg gacccgtgtc       240
     aaaggaatcc gtctcgtcga cggggatcat gacatcgatt gcaagattga tggactcggt       300
     gcgatgaagt tgaagtcgga gttcgttaag aaaatctaa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page