(data stored in ACNUC7421 zone)

EMBL: CP001022.PE158

CP001022.PE158       Location/Qualifiers
FT   CDS_pept        178339..178764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0159"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   bpu:BPUM_1775 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59646"
FT                   /db_xref="GOA:B1YHB4"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB4"
FT                   /protein_id="ACB59646.1"
FT                   /translation="MRGILFAISGGFFLTLQSVANARISNGIGTWQAATLTQMTGFVVA
FT                   LLITLILRDRTFRQMKDVKVLYLSGGALAAAVLFSNMTAVHLMGVTLTISLFLIAQLGL
FT                   ALVIDWNGWFGMIKRRLQLPQVIGILMMIGGVLILKW"
     atgcgtggaa ttttatttgc aatcagcggc ggtttttttc tgaccctgca aagcgtcgcg        60
     aacgcccgga tcagtaatgg tatcggcact tggcaagcag cgacactgac acagatgacc       120
     ggttttgtcg ttgctttatt aatcactttg attttgcgcg atcggacgtt ccggcagatg       180
     aaggacgtga aggtattgta tctatccggt ggggctctgg ccgctgccgt cctgttcagt       240
     aacatgacag ccgtccatct aatgggtgtg acgctgacga tttcgttatt cctgattgcc       300
     cagctcggac tggcactggt gattgattgg aacggttggt tcgggatgat taaacggcgc       360
     ctgcagttgc cgcaagtaat cgggatttta atgatgatcg gcggcgtgct gatcttaaag       420
     tggtaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page